Brand: ProteoGenix

InVivoMAb Anti-Human IL21 (Iv0032)

ARO-A13347-50
Quality Chart

Clonality:: Monoclonal Antibody
Host species:: Mouse

Original price was: €343.00.Current price is: €256.00.

50ug 25% OFF + 256 loyalty points

Size Size

50ug Original price was: €343.00.Current price is: €256.00.
100ug Original price was: €501.00.Current price is: €366.00.
1MG Original price was: €1,369.00.Current price is: €1,061.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

InVivoMAb Anti-Human IL21 (Iv0032)

Product name	ARO-A13347-100
Uniprot ID	Q9HBE4
Raw Antigen Sequence	MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
Buffer	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Mouse
Aliases /Synonyms	Anti-IL-21, Interleukin-21, IL21, Za11
Reference	ARO-A13347
Clonality	Monoclonal Antibody
Protein Name	IL-21

Product name	ARO-A13347-1MG
Uniprot ID	Q9HBE4
Raw Antigen Sequence	MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
Buffer	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Mouse
Aliases /Synonyms	Anti-IL-21, Interleukin-21, IL21, Za11
Reference	ARO-A13347
Clonality	Monoclonal Antibody
Protein Name	IL-21

Product name	ARO-A13347-50
Uniprot ID	Q9HBE4
Raw Antigen Sequence	MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
Buffer	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Mouse
Aliases /Synonyms	Anti-IL-21, Interleukin-21, IL21, Za11
Reference	ARO-A13347
Clonality	Monoclonal Antibody
Protein Name	IL-21