Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Capromab Biosimilar – Anti-FOLH2 mAb – Research Grade

  • PX-TA1078-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €176.00.Current price is: €140.00.

50ug 20% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Capromab Biosimilar - Anti-FOLH2 mAb - Research Grade

Product name Capromab Biosimilar - Anti-FOLH2 mAb - Research Grade
Uniprot ID Q04609
Source CAS 145464-28-4
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Capromab,7E11-C5.3 radiolabelled,Indium In1111 ProstaScint-,capromab pendetide,FOLH2,anti-FOLH2
Reference PX-TA1078
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Capromab Biosimilar - Anti-FOLH2 mAb - Research Grade
Uniprot ID Q04609
Source CAS 145464-28-4
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Capromab,7E11-C5.3 radiolabelled,Indium In1111 ProstaScint-,capromab pendetide,FOLH2,anti-FOLH2
Reference PX-TA1078
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1078-50
Uniprot ID Q04609
Source CAS 145464-28-4
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Capromab,7E11-C5.3 radiolabelled,Indium In1111 ProstaScint-,capromab pendetide,FOLH2,anti-FOLH2
Reference PX-TA1078
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Capromab Biosimilar – Anti-FOLH2 mAb

Capromab Biosimilar, also known as Anti-FOLH2 monoclonal antibody (mAb), is a research grade antibody that has gained significant attention in the field of cancer therapy. This antibody is designed to target the folate hydrolase 2 (FOLH2) protein, which is overexpressed in various types of cancer, making it a promising therapeutic target. In this article, we will discuss the structure, activity, and potential applications of Capromab Biosimilar – Anti-FOLH2 mAb.

Structure of Capromab Biosimilar – Anti-FOLH2 mAb

Capromab Biosimilar is a recombinant humanized monoclonal antibody that is derived from a mouse hybridoma cell line. It is composed of two identical heavy chains and two identical light chains, each containing a variable region and a constant region. The variable region of the antibody is responsible for binding to the FOLH2 protein, while the constant region determines the effector functions of the antibody.

Binding to FOLH2 protein

The FOLH2 protein is a transmembrane glycoprotein that is highly expressed on the surface of cancer cells, particularly in prostate, bladder, and ovarian cancers. It plays a crucial role in tumor growth and progression, making it an attractive target for cancer therapy. Capromab Biosimilar binds to the extracellular domain of FOLH2 with high specificity and affinity, allowing for targeted delivery of therapeutic agents to cancer cells.

Effector functions of Capromab Biosimilar

Apart from its ability to bind to the FOLH2 protein, Capromab Biosimilar also possesses effector functions that contribute to its anti- cancer activity. These include antibody-dependent cellular cytotoxicity (ADCC), complement-dependent cytotoxicity (CDC), and antibody-dependent cellular phagocytosis (ADCP). These functions involve the activation of immune cells, such as natural killer cells and macrophages, to directly kill cancer cells.

Activity of Capromab Biosimilar – Anti-FOLH2 mAb

The primary activity of Capromab Biosimilar is to inhibit the growth and proliferation of cancer cells by targeting the FOLH2 protein. This antibody has been shown to induce cell death in FOLH2-expressing cancer cells, both in vitro and in vivo. Additionally, its effector functions also contribute to its anti- cancer activity by enhancing the immune response against cancer cells.

Potential Applications of Capromab Biosimilar – Anti-FOLH2 mAb

Capromab Biosimilar has the potential to be used in various applications, including cancer diagnosis, imaging, and therapy. Its high specificity for the FOLH2 protein makes it a valuable tool for detecting and imaging FOLH2-expressing tumors. In fact, a radiolabeled version of this antibody, known as ProstaScint, has been approved by the FDA for imaging prostate cancer. Furthermore, Capromab Biosimilar can also be used as a therapeutic agent for cancer treatment, either alone or in combination with other anti- cancer drugs.

Cancer diagnosis and imaging

As mentioned, Capromab Biosimilar can be used for cancer diagnosis and imaging by targeting the FOLH2 protein. This antibody can be labeled with a radioactive isotope, such as technetium-99m, and injected into the patient. The radiolabeled antibody will then bind to FOLH2-expressing tumors, allowing for accurate detection and localization of cancer cells.

Cancer therapy

Capromab Biosimilar can also be used as a therapeutic agent for cancer treatment. Its ability to specifically target and kill FOLH2-expressing cancer cells makes it a promising candidate for targeted therapy. Additionally, its effector functions can enhance the immune response against cancer cells, making it a potential immunotherapy agent.

Flow Cytometry results for Capromab Biosimilar - Anti-FOLH2 mAb - Research Grade

Flow Cytometry results for Capromab Biosimilar - Anti-FOLH2 mAb - Research Grade

Flow-cytometry using FITC anti-human FOLH1 antibody. LNCAP cells were stained with an irrelevant antibody (Blue Histogram) or an FITC anti-human FOLH1 monoclonal antibody (Catalog: PX-TA1078, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Capromab Biosimilar - Anti-FOLH2 mAb - Research Grade

Flow Cytometry results for Capromab Biosimilar - Anti-FOLH2 mAb - Research Grade

Flow-cytometry using anti-human FOLH1 antibody. Untransfected cells (blue Histogram) and Transfected cells (Yellow Histogram) were stained with an anti-human FOLH1 monoclonal antibody (Catalog: PX-TA1078) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a Goat Anti-Mouse IgG H&L Polyclonal Antibody, FITC (abinScience: PTX17818) and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Capromab Biosimilar - Anti-FOLH2 mAb - Research Grade

Flow Cytometry results for Capromab Biosimilar - Anti-FOLH2 mAb - Research Grade

Flow-cytometry using PE anti-human FOLH1 antibody. LNCAP cells were stained with an irrelevant antibody (Blue Histogram) or an PE anti-human FOLH1 monoclonal antibody (Catalog: PX-TA1078, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, and cells analysed on a NovoCyte Flow Cytometer.

SDS-PAGE for Capromab Biosimilar - Anti-FOLH2 mAb - Research Grade

SDS-PAGE for Capromab Biosimilar - Anti-FOLH2 mAb - Research Grade

Capromab Biosimilar - Anti-FOLH2 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Flow Cytometry results for Capromab Biosimilar - Anti-FOLH2 mAb - Research Grade

Flow Cytometry results for Capromab Biosimilar - Anti-FOLH2 mAb - Research Grade

Flow-cytometry using APC anti-human FOLH1 antibody. LNCAP cells were stained with an irrelevant antibody (Blue Histogram) or an APC anti-human FOLH1 monoclonal antibody (Catalog: PX-TA1078, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, and cells analysed on a NovoCyte Flow Cytometer.

Capromab Biosimilar - Anti-FOLH2 mAb - Research Grade

There are no reviews yet.

Be the first to review “Capromab Biosimilar – Anti-FOLH2 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products