Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tosatoxumab ELISA Kit

€1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Tosatoxumab ELISA Kit

Tosatoxumab ELISA Kit

Product name Tosatoxumab ELISA Kit
Uniprot ID P09616
Raw Antigen Sequence MKTRIVSSVTTTLLLGSILMNPVAGAADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX289
Note For research use only.
Sample type Plasma, Serum
Target Tosatoxumab
Immunogen Tosatoxumab

Introduction

Tosatoxumab is a novel monoclonal antibody that has shown promising potential as a therapeutic target for various diseases. In order to accurately measure the levels of this antibody in biological samples, a Tosatoxumab ELISA Kit has been developed. This kit utilizes the enzyme-linked immunosorbent assay (ELISA) technique to detect and quantify Tosatoxumab in a variety of sample types. In this article, we will provide a detailed description of the structure, activity, and application of the Tosatoxumab ELISA Kit.

Structure of the Tosatoxumab ELISA Kit

The Tosatoxumab ELISA Kit consists of several components including microplates, Tosatoxumab-specific antibodies, enzyme-conjugated secondary antibodies, and colorimetric substrates. The microplates are coated with Tosatoxumab-specific antibodies, which are immobilized on the surface. The enzyme-conjugated secondary antibodies are specific for the constant region of Tosatoxumab and are used to detect the bound Tosatoxumab. The colorimetric substrates are added to the reaction mixture and produce a color change in the presence of Tosatoxumab, which can be measured using a spectrophotometer.

Activity of the Tosatoxumab ELISA Kit

The Tosatoxumab ELISA Kit works on the principle of antigen-antibody binding. When a sample containing Tosatoxumab is added to the microplate, the Tosatoxumab-specific antibodies bind to the Tosatoxumab present in the sample. The enzyme-conjugated secondary antibodies then bind to the constant region of Tosatoxumab, forming a sandwich complex. The colorimetric substrate is then added, and in the presence of Tosatoxumab, the substrate is converted into a colored product. The intensity of the color is directly proportional to the amount of Tosatoxumab present in the sample, allowing for accurate quantification.

Application of the Tosatoxumab ELISA Kit

The Tosatoxumab ELISA Kit has a wide range of applications in both research and clinical settings. It can be used to measure the levels of Tosatoxumab in various biological samples, including serum, plasma, and cell culture supernatants. This allows for the monitoring of Tosatoxumab levels in patients receiving treatment with this antibody. The Tosatoxumab ELISA Kit can also be used in preclinical studies to assess the pharmacokinetics and pharmacodynamics of Tosatoxumab.

Furthermore, the Tosatoxumab ELISA Kit can be used to measure the levels of Tosatoxumab in samples from patients with various diseases. This can provide valuable information on the role of Tosatoxumab in these diseases and aid in the development of new treatment strategies. The kit can also be used to screen for potential responders to Tosatoxumab therapy, allowing for personalized treatment approaches.

Conclusion

The Tosatoxumab ELISA Kit is a powerful tool for the accurate measurement of Tosatoxumab levels in biological samples. Its unique structure and activity allow for sensitive and specific detection of this therapeutic antibody. With its wide range of applications, the Tosatoxumab ELISA Kit has the potential to contribute significantly to the understanding and treatment of various diseases. As research on Tosatoxumab continues, the use of this ELISA Kit will become increasingly important in the development and monitoring of this promising therapeutic target.

Tosatoxumab ELISA Kit

There are no reviews yet.

Be the first to review “Tosatoxumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products