Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Edrecolomab Biosimilar – Anti-EPCAM mAb – Research Grade

  • PX-TA1081-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
IgG2a, kappa

Original price was: €196.00.Current price is: €140.00.

50ug 29% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Edrecolomab Biosimilar - Anti-EPCAM mAb - Research Grade

Product name Edrecolomab Biosimilar - Anti-EPCAM mAb - Research Grade
Uniprot ID P16422
Source CAS 156586-89-9
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Edrecolomab,17-1A,EPCAM,anti-EPCAM
Reference PX-TA1081
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2a-kappa
Clonality Monoclonal Antibody
Product name Edrecolomab Biosimilar - Anti-EPCAM mAb - Research Grade
Uniprot ID P16422
Source CAS 156586-89-9
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Edrecolomab,17-1A,EPCAM,anti-EPCAM
Reference PX-TA1081
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2a-kappa
Clonality Monoclonal Antibody
Product name PX-TA1081-50
Uniprot ID P16422
Source CAS 156586-89-9
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Edrecolomab,17-1A,EPCAM,anti-EPCAM
Reference PX-TA1081
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody

Introduction

Edrecolomab Biosimilar, also known as Anti-EPCAM mAb, is a monoclonal antibody that has been developed as a biosimilar version of the original Edrecolomab. This biosimilar has been designed to target the Epithelial Cell Adhesion Molecule (EPCAM), a protein that is overexpressed in various types of cancer cells. In this article, we will discuss the structure, activity, and potential applications of Edrecolomab Biosimilar in the field of cancer research.

Structure of Edrecolomab Biosimilar

Edrecolomab Biosimilar is a monoclonal antibody that is produced through recombinant DNA technology. It is a humanized antibody, meaning that it contains both human and mouse components. The antibody is composed of two heavy chains and two light chains, which are linked together by disulfide bonds. The variable regions of the antibody are responsible for binding to the EPCAM protein, while the constant regions determine the antibody’s effector functions.

Activity of Edrecolomab Biosimilar

The primary activity of Edrecolomab Biosimilar is to bind to EPCAM, a transmembrane glycoprotein that is expressed on the surface of many types of cancer cells. By binding to EPCAM, the antibody can block the interaction between cancer cells and the surrounding tissues, thus inhibiting tumor growth and metastasis. Additionally, Edrecolomab Biosimilar can also induce antibody-dependent cell-mediated cytotoxicity (ADCC), where immune cells such as natural killer cells are activated to kill cancer cells that are bound by the antibody.

Applications of Edrecolomab Biosimilar

Edrecolomab Biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials for its potential use in treating various types of cancer. Some of the potential applications of this biosimilar include:

1. Targeted therapy for colorectal cancer: EPCAM is highly expressed in colorectal cancer cells, making it an ideal target for Edrecolomab Biosimilar. In a phase II clinical trial, this biosimilar was found to be effective in reducing tumor size and improving overall survival in patients with metastatic colorectal cancer.

2. Treatment for other EPCAM-positive cancers: Apart from colorectal cancer, EPCAM is also overexpressed in other types of cancer, such as breast, lung, and pancreatic cancer. Edrecolomab Biosimilar has the potential to be used as a targeted therapy for these cancers as well.

3. Adjuvant therapy for surgery: In some cases, cancer cells can spread and form new tumors after surgery. Edrecolomab Biosimilar can be used as an adjuvant therapy to prevent tumor recurrence by targeting any remaining cancer cells after surgery.

4. Diagnostic tool: Edrecolomab Biosimilar can also be used as a diagnostic tool to detect the presence of EPCAM in cancer cells. This can help in early detection and treatment of cancer.

Conclusion

Edrecolomab Biosimilar, as a biosimilar version of Edrecolomab, has a similar structure and activity in targeting EPCAM. Its potential applications in cancer treatment make it a promising therapeutic option for patients with EPCAM-positive cancers. Further clinical trials and research are needed to fully understand the potential of this biosimilar in the field of cancer research.

SDS-PAGE for Edrecolomab Biosimilar - Anti-EPCAM mAb - Research Grade

SDS-PAGE for Edrecolomab Biosimilar - Anti-EPCAM mAb - Research Grade

Edrecolomab Biosimilar - Anti-EPCAM mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Edrecolomab Biosimilar - Anti-EPCAM mAb binds to Human CD326-EPCAM recombinant protein in indirect ELISA Assay

Edrecolomab Biosimilar - Anti-EPCAM mAb binds to Human CD326-EPCAM recombinant protein in indirect ELISA Assay

Immobilized Human CD326-EPCAM recombinant protein (cat. No.PX-P6119) at 0.5µg/mL (100µL/well) can bind to Edrecolomab Biosimilar - Anti-EPCAM mAb (cat. No.PX-TA1081) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Edrecolomab Biosimilar - Anti-EPCAM mAb - Research Grade

There are no reviews yet.

Be the first to review “Edrecolomab Biosimilar – Anti-EPCAM mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products