Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Apitegromab Biosimilar – Anti-pro-GDF-8 mAb – Research Grade

Isotype:
IgG4, lambda

Original price was: €172.00.Current price is: €140.00.

50ug 19% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Apitegromab Biosimilar - Anti-pro-GDF-8 mAb - Research Grade

Product name Apitegromab Biosimilar - Anti-pro-GDF-8 mAb - Research Grade
Uniprot ID O14793
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Apitegromab,,pro-GDF-8,anti-pro-GDF-8
Reference PX-TA1810
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4 Lambda
Clonality Monoclonal Antibody
Product name Apitegromab Biosimilar - Anti-pro-GDF-8 mAb - Research Grade
Uniprot ID O14793
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Apitegromab,,pro-GDF-8,anti-pro-GDF-8
Reference PX-TA1810
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4 Lambda
Clonality Monoclonal Antibody
Product name PX-TA1810-50
Uniprot ID O14793
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Apitegromab,,pro-GDF-8,anti-pro-GDF-8
Reference PX-TA1810
Note For research use only. Not suitable for human use.
Isotype IgG4, lambda

Introduction to Apitegromab Biosimilar – Anti-pro-GDF-8 mAb – Research Grade

Apitegromab Biosimilar, also known as Anti-pro-GDF-8 monoclonal antibody (mAb), is a research grade therapeutic antibody that is designed to target and inhibit the activity of growth differentiation factor 8 (GDF-8). GDF-8 is a protein that belongs to the transforming growth factor beta (TGF-β) superfamily and is involved in regulating muscle growth and development.

Structure of Apitegromab Biosimilar

Apitegromab Biosimilar is a fully humanized monoclonal antibody that is produced using recombinant DNA technology. It is composed of two identical heavy chains and two identical light chains, each containing variable and constant regions. The variable regions of the antibody are responsible for binding to the specific target, GDF-8, while the constant regions provide stability and effector functions.

The structure of Apitegromab Biosimilar is similar to that of the endogenous human antibodies, which reduces the risk of immunogenicity and increases its efficacy. The antibody has a molecular weight of approximately 150 kDa and a half-life of 21 days, making it suitable for therapeutic use.

Mechanism of Action of Apitegromab Biosimilar

Apitegromab Biosimilar works by binding to GDF-8 and preventing its interaction with its receptor, activin type II receptor (ActRII). This binding inhibits the downstream signaling pathways, such as Smad2/3, which are responsible for regulating muscle growth and differentiation. By blocking the activity of GDF-8, Apitegromab Biosimilar promotes muscle growth and regeneration.

Moreover, Apitegromab Biosimilar also has an Fc region that can interact with immune cells, such as natural killer (NK) cells and macrophages, leading to the destruction of GDF-8-expressing cells. This effector function of the antibody further enhances its therapeutic potential.

Applications of Apitegromab Biosimilar

Apitegromab Biosimilar has potential applications in the treatment of various muscle-wasting disorders, including Duchenne muscular dystrophy (DMD), Becker muscular dystrophy (BMD), and sarcopenia. These conditions are characterized by a loss of muscle mass and strength, and GDF-8 has been identified as a key factor in their pathogenesis.

Preclinical studies have shown promising results for Apitegromab Biosimilar in animal models of DMD and BMD. It has been found to increase muscle mass and strength, improve muscle function, and reduce fibrosis. The antibody has also been shown to have a synergistic effect when used in combination with other therapies, such as corticosteroids, in DMD treatment.

Furthermore, Apitegromab Biosimilar has potential applications in sports medicine, where it can be used to enhance muscle growth and improve performance. It can also be used in the treatment of age-related muscle loss, or sarcopenia, which is a common problem in the elderly population.

Conclusion

In summary, Apitegromab Biosimilar is a research grade therapeutic antibody that targets GDF-8 and promotes muscle growth and regeneration. Its humanized structure, specific mechanism of action, and potential applications make it a promising candidate for the treatment of muscle-wasting disorders. Further research and clinical trials are needed to fully explore the therapeutic potential of this antibody.

SDS-PAGE for Apitegromab Biosimilar - Anti-pro-GDF-8 mAb - Research Grade

SDS-PAGE for Apitegromab Biosimilar - Anti-pro-GDF-8 mAb - Research Grade

Apitegromab Biosimilar - Anti-pro-GDF-8 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Apitegromab Biosimilar - Anti-pro-GDF-8 mAb - Research Grade

  • Sakellariou, P., Walpurgis, K., Thomas, A. et al. Combined detection of inhibitors of the activin receptor signaling pathways (IASPs) by means of LC-HRMS/MS for human doping control. Sci Rep 15, 19887 (2025). https://doi.org/10.1038/s41598-025-03562-y

There are no reviews yet.

Be the first to review “Apitegromab Biosimilar – Anti-pro-GDF-8 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products