Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Venanprubart Biosimilar – Anti-B- and T-lymphocyte attenuator mAb – Research Grade

  • PX-TA2147-50
  • Validated FC
Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: €189.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Venanprubart Biosimilar - Anti-B- and T-lymphocyte attenuator mAb - Research Grade

Product name PX-TA2147-50
Uniprot ID Q7Z6A9
Source CAS: 2635407-50-8
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPTEYASICVRS
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2147
Note For research use only. Not suitable for human use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody
Product name Venanprubart Biosimilar - Anti-B- and T-lymphocyte attenuator mAb - Research Grade
Uniprot ID Q7Z6A9
Source CAS: 2635407-50-8
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPTEYASICVRS
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2147
Note For research use only. Not suitable for human use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody
Product name Venanprubart Biosimilar - Anti-B- and T-lymphocyte attenuator mAb - Research Grade
Uniprot ID Q7Z6A9
Source CAS: 2635407-50-8
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPTEYASICVRS
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2147
Note For research use only. Not suitable for human use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Title: Understanding Venanprubart Biosimilar – Anti-B- and T-lymphocyte attenuator mAb Introduction

Venanprubart Biosimilar is a monoclonal antibody (mAb) that targets the B- and T-lymphocyte attenuator (BTLA) protein. BTLA is a coinhibitory receptor expressed on immune cells, and its activation can suppress immune responses. This biosimilar is a promising therapeutic agent for various immune disorders and has potential applications in research.

Structure of Venanprubart Biosimilar

Venanprubart Biosimilar is a recombinant humanized mAb, meaning it is produced in the laboratory using genetic engineering techniques. It is composed of two identical heavy chains and two identical light chains, each containing variable and constant regions. The variable regions are responsible for binding to BTLA, while the constant regions determine the antibody’s effector functions.

Activity of Venanprubart Biosimilar

Venanprubart Biosimilar binds to BTLA with high specificity and affinity, leading to its activation. This results in the suppression of immune responses, as BTLA is known to inhibit T cell activation and proliferation. This mechanism of action makes Venanprubart Biosimilar a potent immunosuppressant and a potential therapeutic target for autoimmune diseases, organ transplantation, and cancer.

Applications of Venanprubart Biosimilar

1. Treatment of Autoimmune Diseases Autoimmune diseases occur when the immune system mistakenly attacks healthy cells and tissues. Venanprubart Biosimilar can be used to treat various autoimmune diseases, such as rheumatoid arthritis, multiple sclerosis, and psoriasis. By targeting BTLA, it can suppress the overactive immune responses that cause these diseases.

2. Organ Transplantation Organ transplantation is a common treatment for end-stage organ failure. However, the success of transplantation is often hindered by the body’s immune response to the transplanted organ. Venanprubart Biosimilar can be used as an immunosuppressant to prevent organ rejection by inhibiting T cell activation and proliferation.

3.

Cancer Immunotherapy

Cancer cells can evade the immune system by expressing checkpoint proteins, such as BTLA, which inhibit immune responses. Venanprubart Biosimilar can block BTLA and restore the immune system’s ability to recognize and attack cancer cells. It can also enhance the effectiveness of other cancer treatments, such as chemotherapy and radiation therapy.

4. Research Tool Venanprubart Biosimilar can also be used as a research tool to study the role of BTLA in immune responses and its potential as a therapeutic target. It can be used in in vitro and in vivo experiments to investigate the effects of BTLA inhibition on different immune cells and disease models.

Conclusion

Venanprubart Biosimilar is a promising therapeutic agent that targets BTLA, a coinhibitory receptor involved in immune regulation. Its structure, activity, and applications make it a valuable tool for treating various immune disorders and studying the role of BTLA in immune responses. Further research and clinical trials are needed to fully understand the potential of this biosimilar in the treatment of diseases.

SDS-PAGE for Research Grade Venanprubart

SDS-PAGE for Research Grade Venanprubart

Research Grade Venanprubart, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Flow Cytometry results for Research Grade Venanprubart

Flow Cytometry results for Research Grade Venanprubart

Target Cells were stained with an irrelevant antibody or Research Grade Venanprubart at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Venanprubart Biosimilar - Anti-B- and T-lymphocyte attenuator mAb - Research Grade

There are no reviews yet.

Be the first to review “Venanprubart Biosimilar – Anti-B- and T-lymphocyte attenuator mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products