Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Roconkibart Biosimilar – Anti-CTLA-8 mAb – Research Grade

  • PX-TA2137-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: €193.00.Current price is: €140.00.

50ug 27% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Roconkibart Biosimilar - Anti-CTLA-8 mAb - Research Grade

Product name PX-TA2137-50
Uniprot ID Q16552
Source CAS: 2638480-59-6
Origin species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2137
Note For research use only. Not suitable for human use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody
Product name Roconkibart Biosimilar - Anti-CTLA-8 mAb - Research Grade
Uniprot ID Q16552
Source CAS: 2638480-59-6
Origin species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2137
Note For research use only. Not suitable for human use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody
Product name Roconkibart Biosimilar - Anti-CTLA-8 mAb - Research Grade
Uniprot ID Q16552
Source CAS: 2638480-59-6
Origin species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2137
Note For research use only. Not suitable for human use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction

Roconkibart Biosimilar is a research grade anti-CTLA-8 monoclonal antibody (mAb) that has shown promising results in pre-clinical studies as a potential therapeutic agent. In this article, we will discuss the structure, activity, and potential applications of this novel antibody.

Structure of Roconkibart Biosimilar

Roconkibart Biosimilar is a recombinant, humanized IgG1 monoclonal antibody that specifically targets the CTLA-8 protein. The antibody is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable regions are responsible for binding to the target protein, while the constant regions determine the antibody’s effector functions.

The antibody has a molecular weight of approximately 150 kDa and a half-life of 21 days. It is stable at room temperature and can be stored for long periods without losing its activity.

Activity of Roconkibart Biosimilar

Roconkibart Biosimilar binds to CTLA-8 with high affinity and specificity, inhibiting its activity. CTLA-8 is a protein found on the surface of T cells and plays a crucial role in regulating the immune response. By binding to CTLA-8, Roconkibart Biosimilar prevents its interaction with its receptor, CD28, leading to the suppression of T cell activation.

This mechanism of action makes Roconkibart Biosimilar a potential immunosuppressive agent, which can be beneficial in various autoimmune diseases and transplant rejection. Additionally, by inhibiting CTLA-8, the antibody may also enhance anti-tumor immune responses, making it a promising candidate for cancer immunotherapy.

Applications of Roconkibart Biosimilar

Roconkibart Biosimilar is currently being evaluated in pre-clinical studies for its potential therapeutic applications. Some of the diseases that may benefit from this antibody include:

Autoimmune diseases Autoimmune diseases are characterized by an overactive immune response against the body’s own tissues. By inhibiting CTLA-8, Roconkibart Biosimilar can potentially suppress this response and provide relief to patients suffering from diseases like rheumatoid arthritis, multiple sclerosis, and lupus.

Transplant rejection

Organ transplantation is a life-saving procedure, but it comes with the risk of rejection by the recipient’s immune system. Roconkibart Biosimilar may be used in combination with other immunosuppressive drugs to prevent transplant rejection and improve the success rate of these procedures.

Cancer immunotherapy

The ability of Roconkibart Biosimilar to enhance anti-tumor immune responses makes it a promising candidate for cancer immunotherapy. By inhibiting CTLA-8, the antibody can potentially activate T cells and improve their ability to recognize and destroy cancer cells.

Inflammatory diseases

Inflammatory diseases, such as psoriasis and Crohn’s disease, are characterized by chronic inflammation in various tissues. Roconkibart Biosimilar may be used to suppress the immune response and reduce inflammation in these diseases, providing relief to patients.

Conclusion

In summary, Roconkibart Biosimilar is a research grade anti-CTLA-8 monoclonal antibody with a specific structure and mechanism of action. Its potential applications in various diseases make it a promising candidate for further research and development. With ongoing pre-clinical studies, we hope to see this novel antibody being used as a therapeutic agent in the near future.

Research Grade Roconkibart in ELISA Assay

Research Grade Roconkibart in ELISA Assay

Research Grade Roconkibart can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Research Grade Roconkibart

SDS-PAGE for Research Grade Roconkibart

Research Grade Roconkibart, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Roconkibart Biosimilar - Anti-CTLA-8 mAb - Research Grade

There are no reviews yet.

Be the first to review “Roconkibart Biosimilar – Anti-CTLA-8 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products