Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Alpha-synuclein(SNCA)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P37840
Molecular weight:
14.46 kDa

€182.00

50ug + 182 loyalty points
His Met1–Ala140
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Alpha-synuclein(SNCA)

Alpha-synuclein(SNCA)

Product name Alpha-synuclein(SNCA)
Uniprot ID P37840
Uniprot link https://www.uniprot.org/uniprot/P37840
Expression system Prokaryotic expression
Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Molecular weight 14.46 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala140
Protein Accession P37840
Spec:Entrez GeneID 6622
Spec:NCBI Gene Aliases NACP; PARK1; PARK4
Spec:SwissProtID Q13701
NCBI Reference P37840
Aliases /Synonyms Non-A beta component of AD amyloid,Non-A4 component of amyloid precursor,NACP,NACP, PARK1
Reference PX-P4717
Note For research use only
Molecular Constructor
His Met1–Ala140
Product name Alpha-synuclein(SNCA)
Uniprot ID P37840
Uniprot link https://www.uniprot.org/uniprot/P37840
Expression system Prokaryotic expression
Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Molecular weight 14.46 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala140
Protein Accession P37840
Spec:Entrez GeneID 6622
Spec:NCBI Gene Aliases NACP; PARK1; PARK4
Spec:SwissProtID Q13701
NCBI Reference P37840
Aliases /Synonyms Non-A beta component of AD amyloid,Non-A4 component of amyloid precursor,NACP,NACP, PARK1
Reference PX-P4717
Note For research use only
Molecular Constructor
His Met1–Ala140

There are no reviews yet.

Be the first to review “Alpha-synuclein(SNCA)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products