Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Zalifrelimab ELISA Kit

€1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Zalifrelimab ELISA Kit

Zalifrelimab ELISA Kit

Product name Zalifrelimab ELISA Kit
Uniprot ID P16410
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX197
Note For research use only.
Sample type Plasma, Serum
Target Zalifrelimab
Immunogen Zalifrelimab

The Structure of Zalifrelimab ELISA Kit

Zalifrelimab ELISA Kit is a highly sensitive and specific diagnostic tool used in the detection and quantification of Zalifrelimab, a monoclonal antibody used as a therapeutic agent. The kit is composed of several components, including a microplate coated with a specific antibody, a detection antibody, and a colorimetric substrate. The structure of the kit allows for the precise and accurate measurement of Zalifrelimab levels in various biological samples.

The microplate used in the kit is coated with a specific antibody that binds specifically to Zalifrelimab. This antibody is immobilized on the surface of the plate, ensuring that only Zalifrelimab present in the sample will be captured. The microplate is made of a high-quality plastic material that is resistant to chemical reactions, ensuring the stability of the kit components.

The detection antibody used in the kit is a biotinylated monoclonal antibody that recognizes a different epitope on Zalifrelimab. This antibody is labeled with biotin, a vitamin B derivative that binds specifically to streptavidin, an enzyme used in the detection process. The detection antibody is added to the microplate after the sample has been incubated, allowing it to bind to any Zalifrelimab present in the sample.

The Activity of Zalifrelimab ELISA Kit

Zalifrelimab ELISA Kit utilizes the principle of enzyme-linked immunosorbent assay (ELISA) to detect and quantify Zalifrelimab levels in biological samples. The kit is based on the specific binding of Zalifrelimab to two different antibodies, one immobilized on the microplate and the other labeled with biotin. The activity of the kit involves several steps, including sample preparation, incubation, washing, and detection.

The first step in the activity of the kit is the preparation of the sample, which involves the extraction and purification of Zalifrelimab from the biological sample. This step is crucial in ensuring the accuracy and reliability of the results. Once the sample is prepared, it is added to the microplate coated with the specific antibody. Zalifrelimab present in the sample binds to the immobilized antibody, while other components of the sample are washed away.

After the incubation step, the microplate is washed to remove any unbound components. This step ensures the specificity of the assay by removing any non-specific binding. The detection antibody labeled with biotin is then added to the microplate, binding to the captured Zalifrelimab. Streptavidin is then added, which binds to the biotinylated detection antibody, forming an enzyme-antibody complex.

The final step in the activity of the kit is the addition of a colorimetric substrate, which reacts with the enzyme to produce a color change. The intensity of the color is directly proportional to the amount of Zalifrelimab present in the sample. The microplate is then read using a spectrophotometer, and the results are calculated using a standard curve. The activity of the kit is highly sensitive and specific, allowing for the accurate detection and quantification of Zalifrelimab levels in various biological samples.

Application of Zalifrelimab ELISA Kit

Zalifrelimab ELISA Kit has a wide range of applications in both research and clinical settings. In research, the kit is used to study the pharmacokinetics and pharmacodynamics of Zalifrelimab, providing valuable insights into its mechanism of action and potential therapeutic benefits. The kit is also used to monitor Zalifrelimab levels in preclinical and clinical studies, aiding in the development and optimization of dosing regimens.

In clinical settings, Zalifrelimab ELISA Kit is used for the diagnosis and monitoring of patients receiving Zalifrelimab therapy. The kit allows for the precise and accurate measurement of Zalif

Zalifrelimab ELISA Kit

There are no reviews yet.

Be the first to review “Zalifrelimab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products