Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Zalfermin Biosimilar – Anti-FGF21 mAb – Research Grade

Uniprot ID:
Q9NSA1

Original price was: €174.00.Current price is: €140.00.

50ug 20% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Zalfermin Biosimilar - Anti-FGF21 mAb - Research Grade

Product name PX-TA2163-50
Uniprot ID Q9NSA1
Source CAS: 1958040-66-8
Expression system XtenCHO
Raw Antigen Sequence MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2163
Note For research use only. Not suitable for human use.
Isotype Human FGF21
Product name Zalfermin Biosimilar - Anti-FGF21 mAb - Research Grade
Uniprot ID Q9NSA1
Source CAS: 1958040-66-8
Expression system XtenCHO
Raw Antigen Sequence MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2163
Note For research use only. Not suitable for human use.
Isotype Human FGF21
Product name Zalfermin Biosimilar - Anti-FGF21 mAb - Research Grade
Uniprot ID Q9NSA1
Source CAS: 1958040-66-8
Expression system XtenCHO
Raw Antigen Sequence MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2163
Note For research use only. Not suitable for human use.
Isotype Human FGF21

Introduction:

Zalfermin Biosimilar, also known as Anti-FGF21 mAb, is a promising therapeutic antibody that has shown potential in treating various diseases. This biosimilar is a monoclonal antibody that targets fibroblast growth factor 21 (FGF21), a protein involved in metabolic regulation and energy homeostasis. In this article, we will discuss the structure, activity, and potential applications of Zalfermin Biosimilar in detail.

Structure of Zalfermin Biosimilar:

Zalfermin Biosimilar is a recombinant humanized monoclonal antibody, meaning it is produced by cloning and modifying human genes in a laboratory. It is composed of two heavy chains and two light chains, each containing a unique sequence of amino acids. The heavy and light chains are connected by disulfide bonds, forming a Y-shaped structure. This structure is crucial for the antibody’s ability to bind to its target, FGF21.

Activity of Zalfermin Biosimilar:

Zalfermin Biosimilar works by binding to FGF21 and blocking its activity. FGF21 is a hormone-like protein that regulates glucose and lipid metabolism, as well as energy expenditure. In certain diseases, such as obesity and type 2 diabetes, FGF21 levels are dysregulated, leading to metabolic dysfunction. By targeting FGF21, Zalfermin Biosimilar can restore the balance of this protein and improve metabolic function.

Potential Applications of Zalfermin Biosimilar:

Zalfermin Biosimilar has shown promising results in preclinical studies and has the potential to be used in the treatment of various diseases. Some of the potential applications of this biosimilar are discussed below:

1. Obesity:

Obesity is a global health issue that is characterized by excess body fat and is associated with numerous health complications. FGF21 has been shown to play a role in regulating body weight and metabolism. Zalfermin Biosimilar, by targeting FGF21, can potentially help in reducing body weight and improving metabolic parameters in obese individuals.

2. Type 2 Diabetes:

Type 2 diabetes is a metabolic disorder characterized by high blood sugar levels and insulin resistance. FGF21 has been shown to improve insulin sensitivity and glucose homeostasis. Zalfermin Biosimilar, by blocking the activity of FGF21, can potentially improve glucose control and insulin resistance in individuals with type 2 diabetes.

3. Non-Alcoholic Fatty Liver Disease (NAFLD):

NAFLD is a condition characterized by the accumulation of fat in the liver and is closely associated with obesity and type 2 diabetes. FGF21 has been shown to have a protective effect on the liver and can potentially improve liver function in individuals with NAFLD. Zalfermin Biosimilar, by targeting FGF21, can be a potential treatment option for NAFLD.

4. Cardiovascular Diseases:

FGF21 has been shown to have a protective effect on the cardiovascular system by improving lipid profiles and reducing inflammation. Zalfermin Biosimilar, by targeting FGF21, can potentially reduce the risk of cardiovascular diseases such as atherosclerosis and heart disease.

Conclusion:

In conclusion, Zalfermin Biosimilar is a promising therapeutic antibody that targets FGF21 and has the potential to treat various diseases, including obesity, type 2 diabetes, NAFLD, and cardiovascular diseases. Its unique structure and activity make it a promising candidate for further research and development. With more studies and clinical trials, Zalfermin Biosimilar could potentially become a valuable treatment option for individuals suffering from these diseases.

Zalfermin Biosimilar - Anti-FGF21 mAb - Research Grade

There are no reviews yet.

Be the first to review “Zalfermin Biosimilar – Anti-FGF21 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products