Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Vimekofusp Biosimilar – Anti-IL-10 mAb – Research Grade

Uniprot ID:
P22301

Original price was: €178.00.Current price is: €140.00.

50ug 21% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Vimekofusp Biosimilar - Anti-IL-10 mAb - Research Grade

Product name PX-TA2162-50
Uniprot ID P22301
Source CAS: 2771192-33-5
Expression system XtenCHO
Raw Antigen Sequence MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2162
Note For research use only. Not suitable for human use.
Isotype Vibrio cholerae L-methionyl-cholix toxin fragment fused to human IL10
Product name Vimekofusp Biosimilar - Anti-IL-10 mAb - Research Grade
Uniprot ID P22301
Source CAS: 2771192-33-5
Expression system XtenCHO
Raw Antigen Sequence MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2162
Note For research use only. Not suitable for human use.
Isotype Vibrio cholerae L-methionyl-cholix toxin fragment fused to human IL10
Product name Vimekofusp Biosimilar - Anti-IL-10 mAb - Research Grade
Uniprot ID P22301
Source CAS: 2771192-33-5
Expression system XtenCHO
Raw Antigen Sequence MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2162
Note For research use only. Not suitable for human use.
Isotype Vibrio cholerae L-methionyl-cholix toxin fragment fused to human IL10

Introduction

Vimekofusp Biosimilar, also known as Anti-IL-10 mAb, is a research grade antibody that has shown promising results in the treatment of various diseases. This biosimilar is a monoclonal antibody that specifically targets interleukin-10 (IL-10), a cytokine that plays a crucial role in regulating the immune response. In this article, we will discuss the structure, activity, and potential applications of Vimekofusp Biosimilar.

Structure of Vimekofusp Biosimilar

Vimekofusp Biosimilar is a recombinant humanized monoclonal antibody that is produced in a laboratory using genetic engineering techniques. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable region is responsible for binding to IL-10, while the constant region determines the antibody’s effector functions.

Activity of Vimekofusp Biosimilar

Vimekofusp Biosimilar exerts its activity by binding to IL-10 and preventing it from interacting with its receptors on immune cells. IL-10 is a cytokine that has both pro-inflammatory and anti-inflammatory effects, depending on the context. In certain diseases, such as autoimmune disorders, IL-10 promotes inflammation and tissue damage. By blocking IL-10, Vimekofusp Biosimilar helps to reduce inflammation and restore immune balance.

Potential Applications of Vimekofusp Biosimilar

Vimekofusp Biosimilar has shown promising results in preclinical and clinical studies for various diseases. Some of its potential applications include:

1. Autoimmune Diseases: Vimekofusp Biosimilar has been studied for its potential use in autoimmune diseases such as rheumatoid arthritis, Crohn’s disease, and multiple sclerosis. By blocking IL-10, it can help to reduce inflammation and improve symptoms in these conditions.

2.

Cancer: IL-10 has been shown to promote tumor growth and suppress the immune response against cancer cells. Vimekofusp Biosimilar has been investigated as a potential treatment for various types of cancer, including melanoma, pancreatic cancer, and breast cancer. By inhibiting IL-10, it can help to enhance the anti-tumor immune response and inhibit tumor growth.

3. Inflammatory Bowel Disease (IBD): IBD is a chronic inflammatory disorder of the gastrointestinal tract, which includes Crohn’s disease and ulcerative colitis. IL-10 plays a critical role in the pathogenesis of IBD, and Vimekofusp Biosimilar has shown promising results in preclinical studies for the treatment of IBD.

4.

Transplant Rejection: Vimekofusp Biosimilar has also been studied for its potential in preventing transplant rejection. IL-10 has been shown to play a role in promoting immune tolerance and preventing rejection of transplanted organs. By blocking IL-10, Vimekofusp Biosimilar may help to improve the success rate of organ transplantation.

5. Other Inflammatory Conditions: IL-10 has been implicated in the pathogenesis of various other inflammatory conditions, such as psoriasis, asthma, and allergic diseases. Vimekofusp Biosimilar has shown potential for the treatment of these conditions by inhibiting IL-10 and reducing inflammation.

Conclusion

Vimekofusp Biosimilar, also known as Anti-IL-10 mAb, is a research grade antibody that specifically targets IL-10 and has shown promising results in various diseases. Its structure, activity, and potential applications make it a promising candidate for the treatment of autoimmune diseases, cancer, IBD, transplant rejection, and other inflammatory conditions. Further research and clinical trials are needed to fully understand the potential of Vimekofusp Biosimilar and its role in treating these diseases.

Vimekofusp Biosimilar - Anti-IL-10 mAb - Research Grade

There are no reviews yet.

Be the first to review “Vimekofusp Biosimilar – Anti-IL-10 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products