Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Baminercept Alfa Biosimilar – Anti-LT-alpha,beta, LIGHT fusion protein – Research Grade

Uniprot ID:
P01374 & Q06643 & O43557

Original price was: €256.00.Current price is: €200.00.

100ug 22% OFF + 200 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Baminercept Alfa Biosimilar - Anti-LT-alpha,beta, LIGHT fusion protein - Research Grade

Product name Baminercept Alfa Biosimilar - Anti-LT-alpha,beta, LIGHT fusion protein - Research Grade
Uniprot ID P01374 & Q06643 & O43557
Expression system XtenCHO
Raw Antigen Sequence MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-LT-alpha,beta, LIGHT
Reference PX-TA2003
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [LTBR (lymphotoxin beta receptor, TNFRSF3, tumor necrosis factor receptor superfamily (TNFR) member 3, TNFCR)]2 - IGHG1 Fc (Fragment constant)
Product name Baminercept Alfa Biosimilar - Anti-LT-alpha,beta, LIGHT fusion protein - Research Grade
Uniprot ID P01374 & Q06643 & O43557
Expression system XtenCHO
Raw Antigen Sequence MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-LT-alpha,beta, LIGHT
Reference PX-TA2003
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [LTBR (lymphotoxin beta receptor, TNFRSF3, tumor necrosis factor receptor superfamily (TNFR) member 3, TNFCR)]2 - IGHG1 Fc (Fragment constant)
Product name PX-TA2003-50
Uniprot ID P01374 & Q06643 & O43557
Expression system XtenCHO
Raw Antigen Sequence MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-LT-alpha,beta, LIGHT
Reference PX-TA2003
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [LTBR (lymphotoxin beta receptor, TNFRSF3, tumor necrosis factor receptor superfamily (TNFR) member 3, TNFCR)]2 - IGHG1 Fc (Fragment constant)

Introduction

Baminercept Alfa Biosimilar, also known as Anti-LT-alpha,beta, LIGHT fusion protein, is a novel therapeutic agent that has shown promising results in the treatment of various inflammatory diseases. This biosimilar is a fusion protein that combines the properties of two important cytokines, LT-alpha and LIGHT, to target and modulate the immune response. In this scientific web content, we will delve into the structure, activity, and potential applications of Baminercept Alfa Biosimilar as a research grade antibody.

Structure of Baminercept Alfa Biosimilar

Baminercept Alfa Biosimilar is a recombinant fusion protein that consists of two main components, LT-alpha and LIGHT. LT-alpha is a cytokine that belongs to the tumor necrosis factor (TNF) superfamily and is involved in the regulation of immune response and inflammation. LIGHT, on the other hand, is a member of the TNF superfamily that plays a crucial role in the activation of immune cells and the production of pro-inflammatory cytokines.

The fusion protein is created by linking the extracellular domain of LT-alpha to the extracellular domain of LIGHT, resulting in a single molecule with dual activity. This unique structure allows Baminercept Alfa Biosimilar to target and modulate the immune response through two different pathways simultaneously.

Activity of Baminercept Alfa Biosimilar

Baminercept Alfa Biosimilar acts as a competitive inhibitor of LT-alpha and LIGHT, preventing these cytokines from binding to their respective receptors. By blocking the activity of these cytokines, Baminercept Alfa Biosimilar can effectively modulate the immune response and reduce inflammation.

LT-alpha and LIGHT are known to play a crucial role in the development of autoimmune diseases, such as rheumatoid arthritis and inflammatory bowel disease. By inhibiting their activity, Baminercept Alfa Biosimilar has the potential to treat these conditions and provide relief to patients.

Additionally, Baminercept Alfa Biosimilar has been shown to have a synergistic effect with other TNF inhibitors, such as infliximab and etanercept. This means that it can enhance the therapeutic effect of these drugs and potentially reduce the dosage and frequency of administration.

Applications of Baminercept Alfa Biosimilar

As a research grade antibody, Baminercept Alfa Biosimilar has a wide range of potential applications in the field of immunology. It can be used to study the role of LT-alpha and LIGHT in various inflammatory diseases and to develop new therapeutic strategies.

In addition, Baminercept Alfa Biosimilar can also be used as a tool to investigate the mechanism of action of other TNF inhibitors and to explore potential combinations for more effective treatment.

Moreover, Baminercept Alfa Biosimilar has the potential to be developed as a therapeutic agent for various inflammatory diseases. Clinical trials have shown promising results in the treatment of rheumatoid arthritis, psoriasis, and psoriatic arthritis. Further studies are needed to fully understand the potential of this biosimilar in treating these conditions.

Conclusion

In summary, Baminercept Alfa Biosimilar is a novel fusion protein that combines the properties of LT-alpha and LIGHT to target and modulate the immune response. Its unique structure and activity make it a promising therapeutic agent for various inflammatory diseases. As a research grade antibody, it has the potential to advance our understanding of the role of LT-alpha and LIGHT in the immune system and to develop new treatments for autoimmune diseases. Further research and clinical trials are needed to fully explore the potential of Baminercept Alfa Biosimilar in the field of immunology.

SDS-PAGE for Research Grade Baminercept Alfa

SDS-PAGE for Research Grade Baminercept Alfa

Research Grade Baminercept Alfa, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Baminercept Alfa Biosimilar - Anti-LT-alpha,beta, LIGHT fusion protein - Research Grade

There are no reviews yet.

Be the first to review “Baminercept Alfa Biosimilar – Anti-LT-alpha,beta, LIGHT fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products