Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Onacrisantaspase Biosimilar – Anti-L-asparagine amidohydrolase mAb – Research Grade

Uniprot ID:
L-asparagine amidohydrolase

Original price was: €171.00.Current price is: €140.00.

50ug 18% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Onacrisantaspase Biosimilar - Anti-L-asparagine amidohydrolase mAb - Research Grade

Product name PX-TA2157-50
Uniprot ID L-asparagine amidohydrolase
Source CAS: 2256099-52-0
Expression system XtenCHO
Raw Antigen Sequence MQCEEAHVLVLYTGGTIGMKYIDGVYQPEANYLLHAIRDLSLLNDDDYVSTYYSDAEIRPYCLPPLQHSKKRVVYWMIEYDPLLDSSDMTFDDWIHIGKDIQRAYDQYVGFVILHGTDTLAYTACALSFMLENVRKPIVITGAQIPVCEVRSDGRENLIGALIIAANYDIPEVTVYFNNKLFRGNRTVKIDNRSMDAFESPNMLPIAYMDVDIKVNYDSIFRSPSMAPFVVHDQLCRNVGLLRIFPSMSIENVRASLQAPIEGVVLQTFGAGNMPSHRTDIIDELKKAVDRGCIIINCSQCVRGQVDIHYLTGKVLYDMGIIPGSDMTAEAALTKLSYVLSKDCWELVEKKAMMVKNIRGELTVAKAEPLKDLEIVSQMARFLHLSSSHEMKLLCHAIFPQLLCYAASNGDIEMLKALHENGVDLSVVDYNGRNALHVAASAGHVGAVKYLLTQGVSFHLRDQWDENALVSAVKMKNKILIETLRSAGALLSINSRRLGVELCLCASYGDTETLNSWLAAGADINQQDYNGETALHIAVKSRNKQLVHYLLDRDADPYKIDDFNLTPLRHAKKLNLQDLVIRMKKMKKVQ
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2157
Note For research use only. Not suitable for human use.
Isotype Dickeya dadantii L-asparaginase fused at its N-terminus to a hydrophobic random coil proline-alanine-rich peptide.
Product name Onacrisantaspase Biosimilar - Anti-L-asparagine amidohydrolase mAb - Research Grade
Uniprot ID L-asparagine amidohydrolase
Source CAS: 2256099-52-0
Expression system XtenCHO
Raw Antigen Sequence MQCEEAHVLVLYTGGTIGMKYIDGVYQPEANYLLHAIRDLSLLNDDDYVSTYYSDAEIRPYCLPPLQHSKKRVVYWMIEYDPLLDSSDMTFDDWIHIGKDIQRAYDQYVGFVILHGTDTLAYTACALSFMLENVRKPIVITGAQIPVCEVRSDGRENLIGALIIAANYDIPEVTVYFNNKLFRGNRTVKIDNRSMDAFESPNMLPIAYMDVDIKVNYDSIFRSPSMAPFVVHDQLCRNVGLLRIFPSMSIENVRASLQAPIEGVVLQTFGAGNMPSHRTDIIDELKKAVDRGCIIINCSQCVRGQVDIHYLTGKVLYDMGIIPGSDMTAEAALTKLSYVLSKDCWELVEKKAMMVKNIRGELTVAKAEPLKDLEIVSQMARFLHLSSSHEMKLLCHAIFPQLLCYAASNGDIEMLKALHENGVDLSVVDYNGRNALHVAASAGHVGAVKYLLTQGVSFHLRDQWDENALVSAVKMKNKILIETLRSAGALLSINSRRLGVELCLCASYGDTETLNSWLAAGADINQQDYNGETALHIAVKSRNKQLVHYLLDRDADPYKIDDFNLTPLRHAKKLNLQDLVIRMKKMKKVQ
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2157
Note For research use only. Not suitable for human use.
Isotype Dickeya dadantii L-asparaginase fused at its N-terminus to a hydrophobic random coil proline-alanine-rich peptide.
Product name Onacrisantaspase Biosimilar - Anti-L-asparagine amidohydrolase mAb - Research Grade
Uniprot ID L-asparagine amidohydrolase
Source CAS: 2256099-52-0
Expression system XtenCHO
Raw Antigen Sequence MQCEEAHVLVLYTGGTIGMKYIDGVYQPEANYLLHAIRDLSLLNDDDYVSTYYSDAEIRPYCLPPLQHSKKRVVYWMIEYDPLLDSSDMTFDDWIHIGKDIQRAYDQYVGFVILHGTDTLAYTACALSFMLENVRKPIVITGAQIPVCEVRSDGRENLIGALIIAANYDIPEVTVYFNNKLFRGNRTVKIDNRSMDAFESPNMLPIAYMDVDIKVNYDSIFRSPSMAPFVVHDQLCRNVGLLRIFPSMSIENVRASLQAPIEGVVLQTFGAGNMPSHRTDIIDELKKAVDRGCIIINCSQCVRGQVDIHYLTGKVLYDMGIIPGSDMTAEAALTKLSYVLSKDCWELVEKKAMMVKNIRGELTVAKAEPLKDLEIVSQMARFLHLSSSHEMKLLCHAIFPQLLCYAASNGDIEMLKALHENGVDLSVVDYNGRNALHVAASAGHVGAVKYLLTQGVSFHLRDQWDENALVSAVKMKNKILIETLRSAGALLSINSRRLGVELCLCASYGDTETLNSWLAAGADINQQDYNGETALHIAVKSRNKQLVHYLLDRDADPYKIDDFNLTPLRHAKKLNLQDLVIRMKKMKKVQ
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2157
Note For research use only. Not suitable for human use.
Isotype Dickeya dadantii L-asparaginase fused at its N-terminus to a hydrophobic random coil proline-alanine-rich peptide.

Introduction

Onacrisantaspase Biosimilar, also known as Anti-L-asparagine amidohydrolase mAb, is a research grade antibody that has gained significant attention in the field of cancer treatment. This biosimilar is a monoclonal antibody that specifically targets and inhibits the activity of L-asparagine amidohydrolase, an enzyme involved in the metabolism of asparagine. In this article, we will delve into the structure, activity, and potential applications of Onacrisantaspase Biosimilar.

Structure of Onacrisantaspase Biosimilar

Onacrisantaspase Biosimilar is a recombinant humanized monoclonal antibody that is produced using advanced genetic engineering techniques. It is composed of two identical heavy chains and two identical light chains, each containing a variable region and a constant region. The variable regions of the antibody are responsible for binding to the target enzyme, while the constant regions provide stability and determine the antibody’s effector functions.

Activity of Onacrisantaspase Biosimilar

The primary activity of Onacrisantaspase Biosimilar is the inhibition of L-asparagine amidohydrolase, an enzyme that plays a crucial role in the metabolism of asparagine. Asparagine is an essential amino acid required for the growth and survival of cancer cells. By inhibiting L-asparagine amidohydrolase, Onacrisantaspase Biosimilar reduces the availability of asparagine, thereby depriving cancer cells of this vital nutrient and inhibiting their growth.

In addition to its inhibitory activity, Onacrisantaspase Biosimilar also has effector functions that can enhance its anti- cancer effects. These include antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). ADCC involves the binding of the antibody to the target cell, followed by the recruitment of immune cells that can kill the cancer cell. CDC, on the other hand, involves the activation of the complement system, which leads to the formation of pores on the cancer cell’s surface, causing it to burst.

Potential Applications of Onacrisantaspase Biosimilar

Onacrisantaspase Biosimilar has shown promising results in pre-clinical and clinical studies as a potential treatment for various types of cancer. Its ability to inhibit L-asparagine amidohydrolase makes it a potential therapeutic option for cancers that are dependent on asparagine for their growth, such as acute lymphoblastic leukemia (ALL) and some types of lymphoma.

Furthermore, Onacrisantaspase Biosimilar has also shown potential as a combination therapy with other anti- cancer drugs. Studies have demonstrated that combining this biosimilar with chemotherapeutic agents can enhance their effectiveness and reduce their toxic side effects. This is because Onacrisantaspase Biosimilar targets a specific aspect of cancer cell metabolism, making it a complementary treatment to traditional chemotherapy.

Another potential application of Onacrisantaspase Biosimilar is in the treatment of certain autoimmune diseases. Asparagine has been implicated in the pathogenesis of autoimmune disorders, and inhibiting its metabolism with this biosimilar could potentially alleviate symptoms and improve patient outcomes.

Conclusion

Onacrisantaspase Biosimilar, also known as Anti-L-asparagine amidohydrolase mAb, is a research grade antibody with a specific target and multiple potential applications. Its unique structure and inhibitory activity make it a promising therapeutic option for various types of cancer, both as a monotherapy and in combination with other treatments. Further research and clinical trials are needed to fully understand the potential of this biosimilar and its role in the treatment of cancer and other diseases.

Onacrisantaspase Biosimilar - Anti-L-asparagine amidohydrolase mAb - Research Grade

There are no reviews yet.

Be the first to review “Onacrisantaspase Biosimilar – Anti-L-asparagine amidohydrolase mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products