Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Xaluritamig Biosimilar – Anti-STEAP family member 1 and CD3e mAb – Research Grade

  • PX-TA2096-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1-scFv-CH/G1-kappa

Original price was: €189.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Xaluritamig Biosimilar - Anti-STEAP family member 1 and CD3e mAb - Research Grade

Product name Xaluritamig Biosimilar - Anti-STEAP family member 1 and CD3e mAb - Research Grade
Uniprot ID Q9UHE8 & P07766
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-STEAP family member 1, six transmembrane epithelial antigen of the prostate 1, STEAP1 metalloreductase, CD3E
Reference PX-TA2096
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-scFv-CH/G1-kappa
Clonality Monoclonal Antibody
Product name Xaluritamig Biosimilar - Anti-STEAP family member 1 and CD3e mAb - Research Grade
Uniprot ID Q9UHE8 & P07766
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-STEAP family member 1, six transmembrane epithelial antigen of the prostate 1, STEAP1 metalloreductase, CD3E
Reference PX-TA2096
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-scFv-CH/G1-kappa
Clonality Monoclonal Antibody
Product name PX-TA2096-50
Uniprot ID Q9UHE8 & P07766
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-STEAP family member 1, six transmembrane epithelial antigen of the prostate 1, STEAP1 metalloreductase, CD3E
Reference PX-TA2096
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-scFv-CH/G1-kappa
Clonality Monoclonal Antibody

Introduction

Xaluritamig Biosimilar – Anti-STEAP family member 1 and CD3e mAb – Research Grade is a novel antibody therapeutic targeting two key proteins involved in cancer progression: STEAP family member 1 and CD3e. This biosimilar offers a promising treatment option for various types of cancer, with its unique structure and mechanism of action. In this article, we will discuss the structure, activity, and potential applications of Xaluritamig Biosimilar in detail.

Structure of Xaluritamig Biosimilar

Xaluritamig Biosimilar is a monoclonal antibody (mAb) composed of two identical heavy chains and two identical light chains. The heavy chains consist of two constant regions (Fc) and two variable regions (Fab), while the light chains contain one constant region (CL) and one variable region (VL). The constant regions are responsible for the effector functions of the antibody, while the variable regions bind specifically to the target proteins.

Activity of Xaluritamig Biosimilar

Xaluritamig Biosimilar binds to two key proteins involved in cancer progression: STEAP family member 1 and CD3e. STEAP family member 1 is a transmembrane protein that is overexpressed in various types of cancer, including prostate, bladder, and breast cancer. It plays a crucial role in tumor growth, invasion, and metastasis. CD3e, on the other hand, is a protein found on the surface of T cells, which are important immune cells involved in fighting cancer.

By binding to STEAP family member 1, Xaluritamig Biosimilar inhibits its activity, leading to a decrease in tumor growth and metastasis. Additionally, by binding to CD3e, it activates T cells, enhancing their ability to recognize and destroy cancer cells. This dual mechanism of action makes Xaluritamig Biosimilar a potent and effective treatment for cancer.

Applications of Xaluritamig Biosimilar

Xaluritamig Biosimilar has shown promising results in preclinical studies, demonstrating its potential as a therapeutic option for various types of cancer. It has been shown to be effective in inhibiting tumor growth and metastasis in prostate, bladder, and breast cancer models. Additionally, Xaluritamig Biosimilar has also been found to enhance the activity of T cells, making it a potential treatment for hematological malignancies.

Moreover, Xaluritamig Biosimilar has the advantage of being a biosimilar, meaning it is highly similar to an already approved antibody therapeutic. This allows for a faster and more cost-effective development process, making it more accessible to patients in need.

Conclusion

In conclusion, Xaluritamig Biosimilar – Anti-STEAP family member 1 and CD3e mAb – Research Grade is a promising antibody therapeutic targeting two key proteins involved in cancer progression. Its unique structure and dual mechanism of action make it a potent and effective treatment option for various types of cancer. With its potential applications in both solid tumors and hematological malignancies, Xaluritamig Biosimilar offers hope for patients in need of new and effective treatments.

SEC-HPLC of Xaluritamig Biosimilar - Anti-STEAP family member 1 and CD3e mAb - Research Grade

SEC-HPLC of Xaluritamig Biosimilar - Anti-STEAP family member 1 and CD3e mAb - Research Grade

Xaluritamig Biosimilar - Anti-STEAP family member 1 and CD3e mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

SDS-PAGE for Xaluritamig Biosimilar - Anti-STEAP family member 1 and CD3e mAb - Research Grade

SDS-PAGE for Xaluritamig Biosimilar - Anti-STEAP family member 1 and CD3e mAb - Research Grade

Xaluritamig Biosimilar - Anti-STEAP family member 1 and CD3e mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Xaluritamig Biosimilar - Anti-STEAP family member 1 and CD3e mAb - Research Grade

There are no reviews yet.

Be the first to review “Xaluritamig Biosimilar – Anti-STEAP family member 1 and CD3e mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products