Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Visugromab Biosimilar – Anti-GDF15 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: €183.00.Current price is: €140.00.

50ug 23% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Visugromab Biosimilar - Anti-GDF15 mAb - Research Grade

Product name Visugromab Biosimilar - Anti-GDF15 mAb - Research Grade
Uniprot ID Q99988
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MPGQELRTVNGSQMLLVLLVLSWLPHGGALSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Visugromab,,GDF15,anti-GDF15
Reference PX-TA1889
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4 Kappa
Clonality Monoclonal Antibody
Product name Visugromab Biosimilar - Anti-GDF15 mAb - Research Grade
Uniprot ID Q99988
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MPGQELRTVNGSQMLLVLLVLSWLPHGGALSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Visugromab,,GDF15,anti-GDF15
Reference PX-TA1889
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4 Kappa
Clonality Monoclonal Antibody
Product name PX-TA1889-50
Uniprot ID Q99988
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MPGQELRTVNGSQMLLVLLVLSWLPHGGALSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Visugromab,,GDF15,anti-GDF15
Reference PX-TA1889
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Visugromab Biosimilar – Anti-GDF15 mAb – Research Grade: A Promising Antibody for Targeting GDF15 in Therapeutic Applications

Introduction

Visugromab Biosimilar, also known as Anti-GDF15 mAb, is a novel monoclonal antibody that has shown promising potential in targeting the growth differentiation factor 15 (GDF15) in various therapeutic applications. This biosimilar is a research grade antibody that is currently under development and has the potential to revolutionize the treatment of diseases associated with GDF15 dysregulation. In this article, we will delve deeper into the structure, mechanism of action, and potential applications of Visugromab Biosimilar.

Structure of Visugromab Biosimilar

Visugromab Biosimilar is a monoclonal antibody that specifically targets GDF15, a member of the transforming growth factor beta (TGF-β) superfamily. It is a fully humanized IgG1 antibody with a molecular weight of approximately 150 kDa. The antibody is composed of two identical heavy chains and two identical light chains, each containing variable and constant domains. The variable domains of the antibody are responsible for binding to the target GDF15, while the constant domains provide stability and effector functions.

Mechanism of Action

GDF15 is a cytokine that is involved in various physiological and pathological processes, including cancer, inflammation, and metabolic disorders. It has been shown to play a critical role in tumor progression, angiogenesis, and immune evasion. Visugromab Biosimilar binds to GDF15 with high specificity and affinity, thereby blocking its interaction with its receptors and inhibiting its downstream signaling pathways. This leads to the suppression of GDF15-mediated cellular processes, making it a promising therapeutic agent for various diseases.

Applications of Visugromab Biosimilar

Visugromab Biosimilar has shown potential in various pre-clinical studies and is currently being evaluated in clinical trials for the treatment of several diseases. Some of the potential applications of this biosimilar are discussed below:

1.

Cancer Therapy

GDF15 is overexpressed in various types of cancer, and its dysregulation has been linked to tumor growth, metastasis, and resistance to chemotherapy. Visugromab Biosimilar has shown promising results in inhibiting the growth and metastasis of cancer cells by blocking the pro-tumorigenic effects of GDF15. It has also been shown to sensitize cancer cells to chemotherapy, making it a potential adjuvant therapy for cancer treatment.

2. Inflammatory Diseases GDF15 has been implicated in the pathogenesis of several inflammatory diseases, such as rheumatoid arthritis, inflammatory bowel disease, and psoriasis. Visugromab Biosimilar has shown anti-inflammatory effects by inhibiting the production of pro-inflammatory cytokines and reducing the infiltration of immune cells into affected tissues. This makes it a potential therapeutic option for the treatment of inflammatory diseases.

3. Metabolic Disorders GDF15 has been shown to play a role in regulating energy balance, glucose metabolism, and body weight. Dysregulation of GDF15 has been linked to obesity, type 2 diabetes, and other metabolic disorders. Visugromab Biosimilar has the potential to modulate GDF15 signaling and improve metabolic parameters, making it a potential treatment option for these diseases.

4. Cardiovascular Diseases GDF15 has been identified as a biomarker for various cardiovascular diseases, including heart failure, atherosclerosis, and myocardial infarction. Visugromab Biosimilar has shown potential in reducing inflammation and oxidative stress in the cardiovascular system, thereby improving cardiac function and reducing the risk of cardiovascular events.

Conclusion

In conclusion, Visugromab Biosimilar is a promising antibody that specifically targets GDF15 and has shown potential in various therapeutic applications. Its unique mechanism of action and high specificity make it a promising candidate for the treatment of cancer, inflammatory diseases, metabolic disorders, and cardiovascular diseases. Further research and clinical trials are needed to fully explore the potential of this biosimilar and bring it to the market for the benefit of patients.

SDS-PAGE for Visugromab Biosimilar - Anti-GDF15 mAb - Research Grade

SDS-PAGE for Visugromab Biosimilar - Anti-GDF15 mAb - Research Grade

Visugromab Biosimilar - Anti-GDF15 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Visugromab Biosimilar - Anti-GDF15 mAb - Research Grade

There are no reviews yet.

Be the first to review “Visugromab Biosimilar – Anti-GDF15 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products