Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mirikizumab Biosimilar – Anti-IL23A mAb – Research Grade

  • PX-TA1489-100UG
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: €280.00.Current price is: €200.00.

100ug 29% OFF + 200 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Mirikizumab Biosimilar - Anti-IL23A mAb - Research Grade

Product name Mirikizumab Biosimilar - Anti-IL23A mAb - Research Grade
Uniprot ID Q9NPF7
Source CAS 1884201-71-1
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Mirikizumab,LY-3074828,IL23A,anti-IL23A
Reference PX-TA1489
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Mirikizumab Biosimilar - Anti-IL23A mAb - Research Grade
Uniprot ID Q9NPF7
Source CAS 1884201-71-1
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Mirikizumab,LY-3074828,IL23A,anti-IL23A
Reference PX-TA1489
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1489-50
Uniprot ID Q9NPF7
Source CAS 1884201-71-1
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Mirikizumab,LY-3074828,IL23A,anti-IL23A
Reference PX-TA1489
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Mirikizumab Biosimilar – Anti-IL23A mAb – Research Grade

Mirikizumab Biosimilar – Anti-IL23A mAb – Research Grade: A Promising Antibody for Targeting IL-23A

Introduction

Mirikizumab Biosimilar – Anti-IL23A mAb – Research Grade is a novel antibody that has been developed as a biosimilar of the well-known monoclonal antibody, mirikizumab. This biosimilar is specifically designed to target and inhibit the activity of interleukin-23A (IL-23A), a cytokine that plays a crucial role in the pathogenesis of various inflammatory and autoimmune diseases. In this article, we will provide a comprehensive scientific description of the structure, activity, and potential applications of Mirikizumab Biosimilar – Anti-IL23A mAb – Research Grade.

Structure of Mirikizumab Biosimilar – Anti-IL23A mAb – Research Grade

Mirikizumab Biosimilar – Anti-IL23A mAb – Research Grade is a monoclonal antibody that is produced by recombinant DNA technology. It is a fully humanized antibody, meaning that it is derived from human cells and has a structure that closely resembles natural human antibodies. The antibody consists of two identical heavy chains and two identical light chains, each containing variable and constant regions. The variable regions are responsible for binding to the target molecule, IL-23A, while the constant regions determine the effector functions of the antibody.

Mechanism of Action

Mirikizumab Biosimilar – Anti-IL23A mAb – Research Grade works by binding to IL-23A and preventing it from interacting with its receptor, IL-23R. This inhibits the downstream signaling pathways that lead to the production of pro-inflammatory cytokines, such as IL-17 and IL-22. By blocking IL-23A, the antibody effectively reduces the inflammation and tissue damage associated with various diseases, including psoriasis, psoriatic arthritis, and Crohn’s disease.

Potential Applications

As a biosimilar of mirikizumab, Mirikizumab Biosimilar – Anti-IL23A mAb – Research Grade has the potential to be used in the treatment of various inflammatory and autoimmune diseases. It has shown promising results in clinical trials for psoriasis, psoriatic arthritis, and Crohn’s disease, and is currently being evaluated for other conditions, such as ulcerative colitis and ankylosing spondylitis. In addition, the biosimilar form of mirikizumab offers a more affordable treatment option for patients, making it accessible to a larger population.

Advantages of Mirikizumab Biosimilar – Anti-IL23A mAb – Research Grade

Compared to other anti-IL23A therapies, Mirikizumab Biosimilar – Anti-IL23A mAb – Research Grade has several advantages. Firstly, being a biosimilar, it has a similar safety and efficacy profile as the original mirikizumab, making it a reliable treatment option. Secondly, its fully humanized structure reduces the risk of immunogenicity, which is a common issue with other monoclonal antibodies. Lastly, the biosimilar form of mirikizumab is more cost-effective, making it a more accessible option for patients.

Conclusion

Mirikizumab Biosimilar – Anti-IL23A mAb – Research Grade is a promising antibody that has the potential to revolutionize the treatment of inflammatory and autoimmune diseases. Its unique structure, mechanism of

Mirikizumab Biosimilar - Anti-IL23A mAb - Research Grade binds to Human IL23A recombinant protein in ELISA Assay

Mirikizumab Biosimilar - Anti-IL23A mAb - Research Grade binds to Human IL23A recombinant protein in ELISA Assay

Human IL23A recombinant protein(cat. No.PX-P5123) at 0.5µg/mL (100µL/well) can bind Mirikizumab Biosimilar - Anti-IL23A mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Mirikizumab Biosimilar - Anti-IL23A mAb - Research Grade

SDS-PAGE for Mirikizumab Biosimilar - Anti-IL23A mAb - Research Grade

Mirikizumab Biosimilar - Anti-IL23A mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Mirikizumab Biosimilar - Anti-IL23A mAb - Research Grade

There are no reviews yet.

Be the first to review “Mirikizumab Biosimilar – Anti-IL23A mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products