Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ocankitug Biosimilar – Anti-TSLP mAb – Research Grade

  • PX-TA2179-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €188.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Ocankitug Biosimilar - Anti-TSLP mAb - Research Grade

Product name PX-TA2179-50
Uniprot ID Q969D9
Source CAS: 2803351-66-6
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-TSLP, Thymic stromal lymphopoietin
Reference PX-TA2179-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Ocankitug Biosimilar - Anti-TSLP mAb - Research Grade
Uniprot ID Q969D9
Source CAS: 2803351-66-6
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-TSLP, Thymic stromal lymphopoietin
Reference PX-TA2179-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Ocankitug Biosimilar - Anti-TSLP mAb - Research Grade
Uniprot ID Q969D9
Source CAS: 2803351-66-6
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-TSLP, Thymic stromal lymphopoietin
Reference PX-TA2179-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Ocankitug Biosimilar – Anti-TSLP mAb – Research Grade

Ocankitug Biosimilar – Anti-TSLP mAb – Research Grade: A Therapeutic Antibody Targeting TSLP

Ocankitug Biosimilar – Anti-TSLP mAb – Research Grade is a novel therapeutic antibody that specifically targets thymic stromal lymphopoietin (TSLP). TSLP is a cytokine that plays a crucial role in the regulation of immune responses, and its overexpression has been linked to various inflammatory and autoimmune diseases. This biosimilar antibody is designed to mimic the function of the existing anti-TSLP monoclonal antibody, while providing a more cost-effective and accessible option for researchers.

Structure of Ocankitug Biosimilar

Ocankitug Biosimilar is a recombinant humanized monoclonal antibody, meaning it is derived from human genetic material and has been modified to reduce immunogenicity. It is composed of two heavy chains and two light chains, which are linked together by disulfide bonds. The antibody has a molecular weight of approximately 150 kDa and belongs to the IgG1 subclass.

Mechanism of Action

Ocankitug Biosimilar works by binding to TSLP and preventing its interaction with its receptor, TSLPR. This blocks the downstream signaling pathway that leads to the production of pro-inflammatory cytokines and chemokines. By inhibiting TSLP, this biosimilar antibody helps to regulate the immune response and reduce inflammation.

Application of Ocankitug Biosimilar

Ocankitug Biosimilar has potential applications in various inflammatory and autoimmune diseases where TSLP is known to play a role. This includes conditions such as asthma, atopic dermatitis, and rheumatoid arthritis. By targeting TSLP, this biosimilar antibody has the potential to alleviate symptoms and improve the overall disease outcome for patients.

Asthma

Asthma is a chronic respiratory disease characterized by airway inflammation and hyperresponsiveness. TSLP has been shown to play a critical role in the development and maintenance of asthma. By blocking TSLP, Ocankitug Biosimilar can potentially reduce airway inflammation and improve asthma symptoms.

Atopic Dermatitis

Atopic dermatitis is a chronic inflammatory skin disease that is driven by an abnormal immune response. TSLP has been identified as a key cytokine in the pathogenesis of atopic dermatitis. By inhibiting TSLP, Ocankitug Biosimilar can potentially improve the skin barrier function and reduce inflammation in patients with atopic dermatitis.

Rheumatoid Arthritis

Rheumatoid arthritis is an autoimmune disease characterized by chronic joint inflammation. TSLP has been shown to contribute to the progression of rheumatoid arthritis by promoting the production of pro-inflammatory cytokines. By targeting TSLP, Ocankitug Biosimilar can potentially reduce joint inflammation and slow the progression of the disease.

Research Grade Biosimilar Antibody

Ocankitug Biosimilar is specifically designed for research purposes and is not intended for therapeutic use in humans. It is produced under strict quality control measures to ensure consistency and purity, making it a reliable tool for scientists studying TSLP and its role in various diseases.

Conclusion

Ocankitug Biosimilar – Anti-TSLP mAb – Research Grade is a novel therapeutic antibody that targets TSLP, a key cytokine involved in numerous inflammatory and autoimmune diseases. Its structure, mechanism of action, and potential applications make it a promising tool for researchers studying TSLP and its role in disease pathogenesis. By providing a more affordable and accessible option, this biosimilar antibody has the potential to advance research

SDS-PAGE for Ocankitug Biosimilar - Research Grade

SDS-PAGE for Ocankitug Biosimilar - Research Grade

Ocankitug Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SDS-PAGE for Ocankitug Biosimilar - Research Grade

SDS-PAGE for Ocankitug Biosimilar - Research Grade

Ocankitug Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Ocankitug Biosimilar – Anti-TSLP mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products