Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Navenibart Biosimilar – Anti-Plasma prekallikrein mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €178.00.Current price is: €140.00.

50ug 21% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Navenibart Biosimilar - Anti-Plasma prekallikrein mAb - Research Grade

Product name PX-TA2203-50
Uniprot ID P03952
Source CAS: 2803430-16-0
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MILFKQATYFISLFATVSCGCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTSNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRIAYGTQGSSGYSLRLCNTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQSSDGKAQMQSPA
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Plasma prekallikrein, KLK3, Fletcher factor, KLKB1, Kininogenin, Plasma kallikrein, PKK
Reference PX-TA2203-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Navenibart Biosimilar - Anti-Plasma prekallikrein mAb - Research Grade
Uniprot ID P03952
Source CAS: 2803430-16-0
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MILFKQATYFISLFATVSCGCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTSNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRIAYGTQGSSGYSLRLCNTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQSSDGKAQMQSPA
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Plasma prekallikrein, KLK3, Fletcher factor, KLKB1, Kininogenin, Plasma kallikrein, PKK
Reference PX-TA2203-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Navenibart Biosimilar - Anti-Plasma prekallikrein mAb - Research Grade
Uniprot ID P03952
Source CAS: 2803430-16-0
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MILFKQATYFISLFATVSCGCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTSNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRIAYGTQGSSGYSLRLCNTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQSSDGKAQMQSPA
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Plasma prekallikrein, KLK3, Fletcher factor, KLKB1, Kininogenin, Plasma kallikrein, PKK
Reference PX-TA2203-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Navenibart Biosimilar

Navenibart Biosimilar is a therapeutic antibody that has been developed as a biosimilar of the anti-plasma prekallikrein monoclonal antibody (mAb). It is a research grade antibody that has been designed to target the prekallikrein protein, which plays a crucial role in the blood coagulation cascade. In this article, we will discuss the structure, activity, and potential applications of Navenibart Biosimilar in more detail.

Structure of Navenibart Biosimilar

Navenibart Biosimilar is a monoclonal antibody that is produced in a laboratory using recombinant DNA technology. It is a protein molecule that is made up of two heavy chains and two light chains, connected by disulfide bonds. The heavy chains are about 50 kDa in size, while the light chains are about 25 kDa. The antibody has a Y-shaped structure, with two antigen-binding sites located at the tips of the Y.

The amino acid sequence of Navenibart Biosimilar is highly similar to that of the original anti-plasma prekallikrein mAb, with only minor differences due to the manufacturing process. This ensures that the biosimilar has the same target specificity and activity as the original antibody.

Activity of Navenibart Biosimilar

Navenibart Biosimilar works by binding to the prekallikrein protein and inhibiting its activity. Prekallikrein is a precursor protein that is activated during the blood coagulation process. It plays a vital role in the formation of blood clots, which can be beneficial in case of injury or harmful in case of disease.

In certain medical conditions, such as hereditary angioedema, the body produces too much prekallikrein, leading to excessive blood clotting and swelling. Navenibart Biosimilar helps to regulate this process by blocking the activity of prekallikrein, thereby reducing the risk of blood clots and swelling.

Therapeutic Target of Navenibart Biosimilar

The therapeutic target of Navenibart Biosimilar is the prekallikrein protein. This protein is present in the blood and is involved in the coagulation cascade. It is activated by various triggers, such as tissue damage, and plays a crucial role in the formation of blood clots.

By targeting prekallikrein, Navenibart Biosimilar can be used to treat conditions where there is an excess of this protein, such as hereditary angioedema. It can also be used in other conditions where blood clotting needs to be regulated, such as in patients undergoing surgery or those with cardiovascular diseases.

Potential Applications of Navenibart Biosimilar

Navenibart Biosimilar has the potential to be used in various medical conditions where prekallikrein plays a role. Some of the potential applications of this biosimilar include:

– Treatment of hereditary angioedema: Navenibart Biosimilar can be used to prevent and reduce swelling attacks in patients with hereditary angioedema.
– Prevention of blood clots: By inhibiting the activity of prekallikrein, Navenibart Biosimilar can help prevent the formation of blood clots, which can be beneficial in patients with a high risk of blood clots.
– Treatment of cardiovascular diseases: Navenibart Biosimilar may also have potential applications in the treatment of cardiovascular diseases, such as heart attacks and strokes, where blood clotting plays a crucial role.
– Use in surgical procedures: Navenibart Biosimilar can be used in surgical procedures to prevent excessive blood clotting, which can lead to complications such as deep vein thrombosis.

Conclusion

In conclusion, Navenibart Biosimilar is a research grade antibody that has been developed as a biosimilar of the anti-plasma prekallikrein mAb. It

SDS-PAGE for Navenibart Biosimilar - Research Grade

SDS-PAGE for Navenibart Biosimilar - Research Grade

Navenibart Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Navenibart Biosimilar – Anti-Plasma prekallikrein mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products