Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Gevokizumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Gevokizumab ELISA Kit

Gevokizumab ELISA Kit

Product name Gevokizumab ELISA Kit
Uniprot ID P01584
Raw Antigen Sequence MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX132
Note For research use only.
Sample type Plasma, Serum
Target Gevokizumab
Immunogen Gevokizumab

Gevokizumab ELISA Kit: A Powerful Tool for Detecting and Studying Therapeutic Antibody

Gevokizumab ELISA Kit: A Scientific Overview

The Gevokizumab ELISA Kit is a highly sensitive and specific tool used for the detection and quantification of the therapeutic antibody, Gevokizumab, in various biological samples. This kit is designed to provide researchers with a reliable and efficient method for studying the structure, activity, and application of this important therapeutic target.

Structure of Gevokizumab

Gevokizumab is a humanized monoclonal antibody that targets interleukin-1 beta (IL-1β), a pro-inflammatory cytokine involved in various inflammatory diseases such as rheumatoid arthritis, psoriasis, and type 2 diabetes. The antibody is composed of two heavy chains and two light chains, and has a molecular weight of approximately 150 kDa.

Principle of Gevokizumab ELISA Kit

The Gevokizumab ELISA Kit is based on the principle of enzyme-linked immunosorbent assay (ELISA), a widely used technique for the detection and quantification of specific proteins in biological samples. This kit utilizes a sandwich ELISA format, where the antibody-coated plate captures the target antigen (Gevokizumab) present in the sample. The captured antibody is then detected by a secondary enzyme-labeled antibody, and the signal is amplified by the addition of a substrate, resulting in a measurable color change.

Activity of Gevokizumab

Gevokizumab is a potent inhibitor of IL-1β, which plays a crucial role in the inflammatory response. By binding to IL-1β, Gevokizumab prevents its interaction with its receptor and subsequent downstream signaling, thus reducing inflammation and associated symptoms. This activity has been demonstrated in various preclinical and clinical studies, making Gevokizumab a promising therapeutic target for inflammatory diseases.

Application of Gevokizumab ELISA Kit

The Gevokizumab ELISA Kit has a wide range of applications in the field of drug development and research. It can be used to measure the concentration of Gevokizumab in various biological samples, such as serum, plasma, and cell culture supernatant, providing valuable information on drug pharmacokinetics and pharmacodynamics. This kit can also be used to screen and select high-affinity Gevokizumab clones during antibody development, as well as to monitor the stability and quality of Gevokizumab during manufacturing and storage.

Conclusion

The Gevokizumab ELISA Kit is a powerful tool for detecting and studying the therapeutic antibody, Gevokizumab. Its high sensitivity and specificity, along with its easy-to-use format, make it an essential kit for researchers working on Gevokizumab and IL-1β-related diseases. With the increasing interest in Gevokizumab as a potential treatment for various inflammatory conditions, this kit will continue to play a crucial role in advancing drug development and research in this field.

Gevokizumab ELISA Kit

There are no reviews yet.

Be the first to review “Gevokizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products