Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Immunoglobulin G-binding protein G(spg) His Tag

Host species:
Escherichia coli (E.coli)
Origin species:
Streptococcus sp. group G
Uniprot ID:
P19909
Molecular weight:
21.24kDa

€142.00

100ug + 142 loyalty points
Lys314–Glu497 His
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Immunoglobulin G-binding protein G(spg) His Tag

Immunoglobulin G-binding protein G(spg) His Tag

Product name Immunoglobulin G-binding protein G(spg) His Tag
Uniprot ID P19909
Uniprot link https://www.uniprot.org/uniprot/P19909
Origin species Streptococcus sp. group G
Expression system Prokaryotic expression
Sequence MGKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTEHHHHHH
Molecular weight 21.24kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys314-Glu497
Protein Accession P19909
NCBI Reference P19909
Aliases /Synonyms IgG-binding protein G
Reference PX-P4645
Note For research use only
Molecular Constructor
Lys314–Glu497 His
Product name Immunoglobulin G-binding protein G(spg) His Tag
Uniprot ID P19909
Uniprot link https://www.uniprot.org/uniprot/P19909
Origin species Streptococcus sp. group G
Expression system Prokaryotic expression
Sequence MGKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTEHHHHHH
Molecular weight 21.24kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys314-Glu497
Protein Accession P19909
NCBI Reference P19909
Aliases /Synonyms IgG-binding protein G
Reference PX-P4645
Note For research use only
Molecular Constructor
Lys314–Glu497 His

There are no reviews yet.

Be the first to review “Immunoglobulin G-binding protein G(spg) His Tag”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products