Name: IGFBP1 protein - Human IGFBP1 full length Recombinant Protein
SKU: PX-P2077-10
Availability: InStock

Product name	IGFBP1 protein - Human IGFBP1 full length Recombinant Protein
Uniprot ID	P08833
Uniprot link	http://www.uniprot.org/uniprot/P08833
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	MKYLLPTAAAGLLLLAAQPAMA^MDAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYF
Molecular weight	28.74kDa
Protein delivered with Tag?	Yes
Purity estimated	95%
Buffer	PBS, pH 7.5 with 0.2mM β-Met and glycerol 2.5%
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Full-length
Protein Accession	ACO37638.1
Spec:Entrez GeneID	3484
Spec:NCBI Gene Aliases	hIGFBP-1, AFBP, IBP1, PP12, IGF-BP25
Spec:SwissProtID	P08833
NCBI Reference	ACO37638.1
Aliases /Synonyms	IGFBP1 full length, insulin-like Growth Factor proteins binding protein 1, Insulin-like Growth Factor proteins-binding protein 1
Reference	PX-P2077
Note	For research use only

No Products found