Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Vanucizumab ELISA Kit

€1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Vanucizumab ELISA Kit

Vanucizumab ELISA Kit

Product name Vanucizumab ELISA Kit
Uniprot ID P15692 & O15123
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX118
Note For research use only.
Sample type Plasma, Serum
Target Vanucizumab
Immunogen Vanucizumab

The Structure of Vanucizumab ELISA Kit

Vanucizumab ELISA Kit is a highly sensitive and specific diagnostic tool used for the detection and quantification of Vanucizumab, a monoclonal antibody targeting the angiopoietin-2 (Ang-2) and vascular endothelial growth factor (VEGF) pathways. The kit is composed of several components, including a microplate coated with a specific capture antibody, a detection antibody, and a colorimetric substrate. The structure of this ELISA kit allows for the precise and accurate measurement of Vanucizumab levels in various biological samples.

The Activity of Vanucizumab ELISA Kit

The activity of Vanucizumab ELISA Kit is based on the principle of sandwich enzyme-linked immunosorbent assay (ELISA). The capture antibody is immobilized on the surface of the microplate, which specifically binds to Vanucizumab present in the sample. After washing away any unbound substances, the detection antibody is added, which binds to a different epitope on Vanucizumab. This creates a sandwich complex, with the capture antibody, Vanucizumab, and detection antibody all bound together.

The next step involves the addition of a colorimetric substrate, which produces a color change in proportion to the amount of Vanucizumab present in the sample. The intensity of the color is measured using a spectrophotometer, and the results are compared to a standard curve to determine the exact concentration of Vanucizumab in the sample.

The Application of Vanucizumab ELISA Kit

Vanucizumab ELISA Kit has a wide range of applications in both research and clinical settings. It is primarily used for the quantitative measurement of Vanucizumab levels in serum, plasma, and other biological fluids. This allows for the monitoring of Vanucizumab levels in patients undergoing treatment with this therapeutic antibody.

One of the main applications of Vanucizumab ELISA Kit is in the field of oncology. Vanucizumab is currently being investigated as a potential treatment for various types of cancer, including colorectal, ovarian, and lung cancer. The ELISA kit can be used to measure Vanucizumab levels in cancer patients, which can help in the assessment of treatment response and the identification of potential biomarkers for disease progression.

Apart from

cancer, Vanucizumab ELISA Kit can also be used in other disease areas such as ophthalmology and inflammatory diseases. In ophthalmology, Vanucizumab is being studied as a potential treatment for neovascular age-related macular degeneration (AMD), and the ELISA kit can be used to monitor Vanucizumab levels in patients undergoing treatment for this condition.

In addition to its diagnostic applications, Vanucizumab ELISA Kit can also be used in preclinical and clinical studies to evaluate the pharmacokinetics and pharmacodynamics of Vanucizumab. By accurately measuring the levels of this therapeutic antibody in biological samples, researchers can gain valuable insights into its mechanism of action and optimize dosing regimens for maximum efficacy.

In conclusion, Vanucizumab ELISA Kit is a valuable tool for the quantification of Vanucizumab levels in various biological samples. Its sensitive and specific nature makes it an essential component in the development and monitoring of this promising therapeutic antibody. With its wide range of applications, Vanucizumab ELISA Kit is a crucial tool for researchers and clinicians in the field of oncology, ophthalmology, and other disease areas.

Vanucizumab ELISA Kit

There are no reviews yet.

Be the first to review “Vanucizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products