Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Vandortuzumab Biosimilar – Anti-STEAP1 mAb – Research Grade

  • PX-TA1370-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €178.00.Current price is: €140.00.

50ug 21% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Vandortuzumab Biosimilar - Anti-STEAP1 mAb - Research Grade

Product name Vandortuzumab Biosimilar - Anti-STEAP1 mAb - Research Grade
Uniprot ID Q9UHE8
Source CAS 1471985-92-8
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Vandortuzumab,DSTP-3086S,DSTP3086S,MSTP2109A,RG-7450,RG7450,STEAP1,anti-STEAP1
Reference PX-TA1370
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Vandortuzumab Biosimilar - Anti-STEAP1 mAb - Research Grade
Uniprot ID Q9UHE8
Source CAS 1471985-92-8
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Vandortuzumab,DSTP-3086S,DSTP3086S,MSTP2109A,RG-7450,RG7450,STEAP1,anti-STEAP1
Reference PX-TA1370
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1370-50
Uniprot ID Q9UHE8
Source CAS 1471985-92-8
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Vandortuzumab,DSTP-3086S,DSTP3086S,MSTP2109A,RG-7450,RG7450,STEAP1,anti-STEAP1
Reference PX-TA1370
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Vandortuzumab Biosimilar

Vandortuzumab Biosimilar, also known as Anti-STEAP1 mAb, is a monoclonal antibody that specifically targets the STEAP1 protein. This biosimilar is a research grade antibody that has been developed as a potential therapeutic agent for various diseases.

Structure of Vandortuzumab Biosimilar

Vandortuzumab Biosimilar is a recombinant humanized monoclonal antibody that has been designed to mimic the structure and function of the naturally occurring antibody. It is composed of two heavy chains and two light chains, each containing variable and constant regions. The variable regions of the antibody are responsible for binding to the STEAP1 protein, while the constant regions play a role in immune system activation.

Activity of Vandortuzumab Biosimilar

The main activity of Vandortuzumab Biosimilar is to bind to the STEAP1 protein, which is overexpressed in various types of cancer cells. This binding leads to the inhibition of STEAP1 function, which is involved in cell proliferation, migration, and invasion. By targeting STEAP1, Vandortuzumab Biosimilar can potentially block the growth and spread of cancer cells.

In addition to its anti-

cancer activity, Vandortuzumab Biosimilar also has immunomodulatory effects. It can activate the immune system to recognize and attack cancer cells, leading to a more robust and effective anti-tumor response.

Application of Vandortuzumab Biosimilar

Vandortuzumab Biosimilar has been investigated as a potential therapeutic agent for various types of cancer, including prostate, breast, and bladder cancer. It has shown promising results in preclinical studies, demonstrating its ability to inhibit tumor growth and improve survival rates.

In addition to its potential as a cancer treatment, Vandortuzumab Biosimilar has also been studied as a diagnostic tool. Its ability to specifically target STEAP1 makes it a valuable tool for detecting the presence of STEAP1 in cancer cells, which can aid in the diagnosis and monitoring of cancer.

Conclusion

In summary, Vandortuzumab Biosimilar is a research grade monoclonal antibody that specifically targets the STEAP1 protein. Its structure and activity make it a promising therapeutic agent for various types of cancer, with potential applications in both treatment and diagnosis. Further research and clinical trials are needed to fully evaluate the efficacy and safety of Vandortuzumab Biosimilar, but it holds great potential as a novel anti- cancer therapy.

SDS-PAGE for Vandortuzumab Biosimilar - Anti-STEAP1 mAb - Research Grade

SDS-PAGE for Vandortuzumab Biosimilar - Anti-STEAP1 mAb - Research Grade

Vandortuzumab Biosimilar - Anti-STEAP1 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Vandortuzumab Biosimilar - Anti-STEAP1 mAb - Research Grade binds to Recombinant Human STEAP1 Protein, N-GST in ELISA Assay

Vandortuzumab Biosimilar - Anti-STEAP1 mAb - Research Grade binds to Recombinant Human STEAP1 Protein, N-GST in ELISA Assay

Recombinant Human STEAP1 Protein, N-GST(cat. No.ARO-P15431) at 0.5µg/mL (100µL/well) can bind Vandortuzumab Biosimilar - Anti-STEAP1 mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

Vandortuzumab Biosimilar - Anti-STEAP1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Vandortuzumab Biosimilar – Anti-STEAP1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products