Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

STT-5058 Biosimilar – Anti-APOC3 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €188.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

STT-5058 Biosimilar - Anti-APOC3 mAb - Research Grade

Product name STT-5058 Biosimilar - Anti-APOC3 mAb - Research Grade
Uniprot ID P02656
Source ARGX-116
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-APOC3, Apolipoprotein C3; Apo-CIII; Apolipoprotein C-III; ApoC-III,ARGX-116
Reference PX-TA1897
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-Kappa
Clonality Monoclonal Antibody
Product name STT-5058 Biosimilar - Anti-APOC3 mAb - Research Grade
Uniprot ID P02656
Source ARGX-116
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-APOC3, Apolipoprotein C3; Apo-CIII; Apolipoprotein C-III; ApoC-III,ARGX-116
Reference PX-TA1897
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-Kappa
Clonality Monoclonal Antibody
Product name PX-TA1897-50
Uniprot ID P02656
Source ARGX-116
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-APOC3, Apolipoprotein C3; Apo-CIII; Apolipoprotein C-III; ApoC-III,ARGX-116
Reference PX-TA1897
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to STT-5058 Biosimilar – Anti-APOC3 mAb

STT-5058 Biosimilar – Anti-APOC3 mAb is a novel biosimilar antibody that targets apolipoprotein C3 (APOC3), a key protein involved in lipid metabolism and cardiovascular diseases. This research grade antibody has shown promising results in pre-clinical studies and has the potential to be a highly effective therapeutic option for patients with dyslipidemia and other related disorders.

Structure of STT-5058 Biosimilar – Anti-APOC3 mAb

STT-5058 Biosimilar – Anti-APOC3 mAb is a monoclonal antibody that is designed to specifically bind to APOC3. It is composed of two heavy chains and two light chains, each containing variable and constant regions. The variable regions are responsible for binding to APOC3, while the constant regions determine the antibody’s effector functions.

Mechanism of Action

STT-5058 Biosimilar – Anti-APOC3 mAb works by binding to APOC3 and inhibiting its function. APOC3 is known to inhibit the activity of lipoprotein lipase, an enzyme responsible for breaking down triglycerides. By blocking APOC3, STT-5058 Biosimilar – Anti-APOC3 mAb increases the activity of lipoprotein lipase, leading to a decrease in triglyceride levels. This mechanism also helps to reduce the levels of low-density lipoprotein (LDL) cholesterol, commonly known as “bad” cholesterol.

Title: Potential Applications

STT-5058 Biosimilar – Anti-APOC3 mAb has the potential to be used in the treatment of dyslipidemia, a condition characterized by abnormal levels of lipids in the blood. High levels of triglycerides and LDL cholesterol are major risk factors for cardiovascular diseases, such as heart attack and stroke. By reducing these levels, STT-5058 Biosimilar – Anti-APOC3 mAb can help to prevent these life-threatening conditions.

In addition to dyslipidemia, STT-5058 Biosimilar – Anti-APOC3 mAb may also have potential applications in other disorders related to lipid metabolism, such as familial hypercholesterolemia and metabolic syndrome. These conditions are also associated with an increased risk of cardiovascular diseases and can benefit from the use of this antibody.

Advantages of STT-5058 Biosimilar – Anti-APOC3 mAb

One of the major advantages of STT-5058 Biosimilar – Anti-APOC3 mAb is its specificity for APOC3. This means that it does not interfere with other proteins or pathways in the body, reducing the risk of side effects. Additionally, as a biosimilar antibody, it is produced using advanced biotechnology methods, ensuring high purity and consistency in its structure and function.

Title: Pre-clinical Studies

Pre-clinical studies have shown promising results for STT-5058 Biosimilar – Anti-APOC3 mAb. In animal models, it has been shown to effectively reduce triglyceride and LDL cholesterol levels, as well as improve other lipid parameters. These results have been consistent across multiple studies, indicating the potential for this antibody to be a highly effective therapeutic option.

Future Directions

STT-5058 Biosimilar – Anti-APOC3 mAb is currently in the pre-clinical stage, with plans for clinical trials in the near future. If successful, this antibody has the potential to become a valuable addition to the treatment options for dyslipidemia and other related disorders. Further research and development may also explore its potential in other areas, such as combination therapy with existing lipid-lowering drugs.

In conclusion, STT-5058 Biosimilar – Anti-APOC3 mAb is a promising biosimilar antibody that targets APOC3 and has the potential to effectively reduce triglyceride and LDL cholesterol levels. Its specificity and advanced production methods make it a promising therapeutic option for patients with dyslipidemia and other related disorders

SDS-PAGE for STT-5058 Biosimilar - Anti-APOC3 mAb - Research Grade

SDS-PAGE for STT-5058 Biosimilar - Anti-APOC3 mAb - Research Grade

STT-5058 Biosimilar - Anti-APOC3 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

STT-5058 Biosimilar - Anti-APOC3 mAb - Research Grade

There are no reviews yet.

Be the first to review “STT-5058 Biosimilar – Anti-APOC3 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products