Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tifcemalimab Biosimilar – Anti-BTLA mAb – Research Grade

  • PX-TA1886-100
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: €270.00.Current price is: €200.00.

100ug 26% OFF + 200 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Tifcemalimab Biosimilar - Anti-BTLA mAb - Research Grade

Product name Tifcemalimab Biosimilar - Anti-BTLA mAb - Research Grade
Uniprot ID Q7Z6A9
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPTEYASICVRS
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Tifcemalimab,,BTLA,anti-BTLA
Reference PX-TA1886
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4 Kappa
Clonality Monoclonal Antibody
Product name Tifcemalimab Biosimilar - Anti-BTLA mAb - Research Grade
Uniprot ID Q7Z6A9
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPTEYASICVRS
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Tifcemalimab,,BTLA,anti-BTLA
Reference PX-TA1886
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4 Kappa
Clonality Monoclonal Antibody
Product name PX-TA1886-50
Uniprot ID Q7Z6A9
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPTEYASICVRS
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Tifcemalimab,,BTLA,anti-BTLA
Reference PX-TA1886
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Tifcemalimab Biosimilar: A Promising Anti-BTLA mAb for Therapeutic Targeting

Tifcemalimab Biosimilar, also known as Anti-BTLA mAb, is a novel monoclonal antibody (mAb) that has shown great potential in the field of immunotherapy. This biosimilar is designed to target the immune checkpoint protein BTLA (B- and T-lymphocyte attenuator), which plays a crucial role in regulating immune responses. In this article, we will explore the structure, activity, and potential applications of Tifcemalimab Biosimilar as a therapeutic agent.

Structure of Tifcemalimab Biosimilar

Tifcemalimab Biosimilar is a fully humanized IgG4 monoclonal antibody, which means it is derived from human genetic sequences and has a lower potential for immunogenicity compared to other mAbs derived from non-human sources. It is composed of two heavy chains and two light chains, each containing specific regions that determine its binding specificity and effector functions.

The variable regions of Tifcemalimab Biosimilar are responsible for its binding to BTLA, while the constant regions are responsible for its effector functions, such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). This unique structure allows Tifcemalimab Biosimilar to target BTLA and modulate immune responses without causing significant side effects.

Activity of Tifcemalimab Biosimilar

Tifcemalimab Biosimilar works by blocking the interaction between BTLA and its ligand, HVEM (herpesvirus entry mediator). This interaction normally results in the suppression of T-cell activation and proliferation, which is important for maintaining immune homeostasis. However, in certain cancers, this interaction can also lead to the inhibition of anti-tumor immune responses.

By blocking the BTLA-HVEM interaction, Tifcemalimab Biosimilar restores the activation and proliferation of T-cells, which can then mount an effective anti-tumor response. This mechanism of action makes Tifcemalimab Biosimilar a promising therapeutic agent for the treatment of various cancers, including melanoma, lung cancer, and gastric cancer.

Potential Applications of Tifcemalimab Biosimilar

Tifcemalimab Biosimilar is currently being evaluated in multiple clinical trials as a potential treatment for various types of cancer. In a phase 1 clinical trial, Tifcemalimab Biosimilar showed promising results in patients with advanced solid tumors, with an overall response rate of 27.8%. In another phase 1 trial, Tifcemalimab Biosimilar demonstrated efficacy in patients with advanced hepatocellular carcinoma, with an overall response rate of 33.3%.

Aside from its potential in cancer treatment, Tifcemalimab Biosimilar is also being studied in other disease areas. BTLA has been implicated in the development of autoimmune diseases, such as rheumatoid arthritis and multiple sclerosis. By targeting BTLA, Tifcemalimab Biosimilar may have the potential to treat these diseases by modulating the immune system.

Conclusion

Tifcemalimab Biosimilar, also known as Anti-BTLA mAb, is a promising therapeutic agent that targets the immune checkpoint protein BTLA. Its unique structure and mechanism of action make it a potential treatment for various types of cancer and autoimmune diseases. As more clinical trials are conducted, we can expect to see Tifcemalimab Biosimilar become a valuable addition to the arsenal of immunotherapies available for patients.

Keywords: Tifcemalimab Biosimilar, Anti-BTLA mAb, monoclonal antibody, immune checkpoint, BTLA, HVEM, cancer, autoimmune diseases, immunotherapy

Tifcemalimab Biosimilar - Anti-CD272;BTLA mAb - Research Grade binds to Recombinant Human BTLA Protein, N-His in ELISA Assay

Tifcemalimab Biosimilar - Anti-CD272;BTLA mAb - Research Grade binds to Recombinant Human BTLA Protein, N-His in ELISA Assay

Recombinant Human BTLA Protein, N-His(cat. No.ARO-P17371) at 0.5µg/mL (100µL/well) can bind Tifcemalimab Biosimilar - Anti-CD272;BTLA mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

Tifcemalimab Biosimilar - Anti-BTLA mAb - Research Grade

There are no reviews yet.

Be the first to review “Tifcemalimab Biosimilar – Anti-BTLA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products