Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human BAFF – TNFSF13B – CD257 recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q9Y275
Molecular weight:
20.28kDa

Original price was: €256.00.Current price is: €210.00.

50ug 18% OFF + 210 loyalty points
Partial Yes
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human BAFF - TNFSF13B - CD257 recombinant protein

Product name Human BAFF - TNFSF13B - CD257 recombinant protein
Uniprot ID Q9Y275
Uniprot link http://www.uniprot.org/uniprot/Q9Y275
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MKHLWFFLLLVAAPRWVLSAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLLGSHHHHHH
Molecular weight 20.28kDa
Protein delivered with Tag? Yes
Purity estimated 50%
Buffer 50 mM Tris-HCl, pH 8.0, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms BLyS, TNFSF13B, Tumor necrosis factor ligand superfamily member 13B, B-cell-activating factor, BAFF, Dendritic cell-derived TNF-like molecule, TNF- and APOL-related leukocyte expressed ligand 1, TALL-1, CD257,BAFF, BLYS, TALL1, TNFSF20, ZTNF4
Reference PX-P4012
Note For research use only
Molecular Constructor
Partial Yes
Product name Human BAFF - TNFSF13B - CD257 recombinant protein
Uniprot ID Q9Y275
Uniprot link http://www.uniprot.org/uniprot/Q9Y275
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MKHLWFFLLLVAAPRWVLSAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLLGSHHHHHH
Molecular weight 20.28kDa
Protein delivered with Tag? Yes
Purity estimated 50%
Buffer 50 mM Tris-HCl, pH 8.0, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms BLyS, TNFSF13B, Tumor necrosis factor ligand superfamily member 13B, B-cell-activating factor, BAFF, Dendritic cell-derived TNF-like molecule, TNF- and APOL-related leukocyte expressed ligand 1, TALL-1, CD257,BAFF, BLYS, TALL1, TNFSF20, ZTNF4
Reference PX-P4012
Note For research use only
Molecular Constructor
Partial Yes
Product name PX-P4012-1MG
Uniprot ID Q9Y275
Uniprot link http://www.uniprot.org/uniprot/Q9Y275
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MKHLWFFLLLVAAPRWVLSAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLLGSHHHHHH
Molecular weight 20.28kDa
Protein delivered with Tag? Yes
Purity estimated 50%
Buffer 50 mM Tris-HCl, pH 8.0, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms BLyS, TNFSF13B, Tumor necrosis factor ligand superfamily member 13B, B-cell-activating factor, BAFF, Dendritic cell-derived TNF-like molecule, TNF- and APOL-related leukocyte expressed ligand 1, TALL-1, CD257,BAFF, BLYS, TALL1, TNFSF20, ZTNF4
Reference PX-P4012
Note For research use only
Molecular Constructor
Partial Yes

Human BAFF - TNFSF13B - CD257 recombinant protein

There are no reviews yet.

Be the first to review “Human BAFF – TNFSF13B – CD257 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products