Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tremelimumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Tremelimumab ELISA Kit

Tremelimumab ELISA Kit

Product name Tremelimumab ELISA Kit
Uniprot ID P16410
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX196
Note For research use only.
Sample type Plasma, Serum
Target Tremelimumab
Immunogen Tremelimumab

Tremelimumab ELISA Kit: A Comprehensive Guide Introduction

Tremelimumab is a monoclonal antibody that has shown promising results in cancer immunotherapy. It targets the cytotoxic T-lymphocyte-associated protein 4 (CTLA-4), a protein that regulates the immune response and is overexpressed in many types of cancer. The Tremelimumab ELISA Kit is a powerful tool for measuring the levels of this antibody in biological samples. In this article, we will delve into the structure, activity, and applications of the Tremelimumab ELISA Kit.

Structure of Tremelimumab

Tremelimumab is a fully human IgG2 monoclonal antibody with a molecular weight of approximately 150 kDa. It is composed of two heavy chains and two light chains, each containing variable and constant regions. The variable regions are responsible for binding to CTLA-4, while the constant regions determine the antibody’s effector functions.

Activity of Tremelimumab

Tremelimumab binds to CTLA-4 with high affinity, preventing it from interacting with its ligands, CD80 and CD86. This leads to the activation of T cells, which play a crucial role in the immune response against cancer cells. By blocking CTLA-4, Tremelimumab enhances the anti-tumor activity of T cells, leading to tumor regression.

Application of Tremelimumab ELISA Kit

The Tremelimumab ELISA Kit is a valuable tool for measuring the levels of this antibody in various biological samples. It is commonly used in research studies to evaluate the pharmacokinetics of Tremelimumab and to monitor its levels in patients undergoing treatment. Additionally, the kit can also be used to assess the levels of Tremelimumab in preclinical models, providing valuable insights into its efficacy and safety.

Measuring Tremelimumab Levels in Serum

One of the main applications of the Tremelimumab ELISA Kit is to measure the levels of this antibody in serum samples. This is crucial for monitoring the response to treatment and determining the optimal dosage for each patient. The kit utilizes a sandwich ELISA method, where the Tremelimumab in the sample is captured by a specific antibody coated on the plate and then detected by a second antibody labeled with an enzyme. The intensity of the color produced is directly proportional to the amount of Tremelimumab present in the sample.

Assessing Tremelimumab Levels in Tumor Tissue

In addition to serum samples, the Tremelimumab ELISA Kit can also be used to measure the levels of this antibody in tumor tissue. This is particularly useful for evaluating the penetration of Tremelimumab into the tumor and its binding to CTLA-4. By measuring the levels of Tremelimumab in both serum and tumor tissue, researchers can gain a better understanding of its pharmacokinetics and mechanism of action.

Detecting Anti-Drug Antibodies (ADAs)

Another important application of the Tremelimumab ELISA Kit is the detection of ADAs, which are antibodies produced by the body in response to Tremelimumab treatment. These antibodies can potentially neutralize the therapeutic effects of Tremelimumab and may also lead to adverse reactions. The kit utilizes a competitive ELISA method to detect ADAs in serum samples, providing valuable information for patient safety and treatment efficacy.

Conclusion

The Tremelimumab ELISA Kit is a powerful tool for measuring the levels of this important antibody in various biological samples. Its high sensitivity, specificity, and ease of use make it an essential tool for researchers and clinicians working in the field of cancer immunotherapy. By providing valuable insights into the pharmacokinetics, mechanism of action, and safety of Tremelimumab, this kit contributes to the advancement of cancer treatment and brings us one step closer to a cure.

Tremelimumab ELISA Kit

There are no reviews yet.

Be the first to review “Tremelimumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products