Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tezepelumab Biosimilar – Anti-TSLP mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG2-lambda

Original price was: €189.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Tezepelumab Biosimilar - Anti-TSLP mAb - Research Grade

Product name Tezepelumab Biosimilar - Anti-TSLP mAb - Research Grade
Uniprot ID Q969D9
Source CAS 1572943-04-4
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Tezepelumab,AMG 157,AMG-157,MEDI-9929,MEDI9929,anti-TSLP-Receptor (TSLP-R; Crl2),TSLP,anti-TSLP
Reference PX-TA1399
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-lambda
Clonality Monoclonal Antibody
Product name Tezepelumab Biosimilar - Anti-TSLP mAb - Research Grade
Uniprot ID Q969D9
Source CAS 1572943-04-4
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Tezepelumab,AMG 157,AMG-157,MEDI-9929,MEDI9929,anti-TSLP-Receptor (TSLP-R; Crl2),TSLP,anti-TSLP
Reference PX-TA1399
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-lambda
Clonality Monoclonal Antibody
Product name PX-TA1399-50
Uniprot ID Q969D9
Source CAS 1572943-04-4
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Tezepelumab,AMG 157,AMG-157,MEDI-9929,MEDI9929,anti-TSLP-Receptor (TSLP-R; Crl2),TSLP,anti-TSLP
Reference PX-TA1399
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-lambda
Clonality Monoclonal Antibody

General information on Anti-TSLP[Homo sapiens] (Tezepelumab) Monoclonal Antibody

Tezepelumab is investigated in the treatment of Oral Corticosteroid Dependent Asthma.

SDS-PAGE for Tezepelumab Biosimilar - Anti-TSLP mAb

SDS-PAGE for Tezepelumab Biosimilar - Anti-TSLP mAb

Tezepelumab Biosimilar - Anti-TSLP mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Tezepelumab Biosimilar - Anti-TSLP mAb - Research Grade

There are no reviews yet.

Be the first to review “Tezepelumab Biosimilar – Anti-TSLP mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products