Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD123/IL3RA Monoclonal Antibody

Original price was: €375.00.Current price is: €274.00.

50ug 27% OFF + 274 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD123/IL3RA Monoclonal Antibody

Product name ARO-A16077-100
Uniprot ID P26951
Uniprot link P26951
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms IL-3R subunit alpha, IL-3 receptor subunit alpha, CD123, Interleukin-3 receptor subunit alpha, IL3R, IL-3R-alpha, IL3RA, IL-3RA
Reference ARO-A16077
Isotype IgG2, Kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD123/IL3RA
Clone Name SAA0045
Protein Name CD123/IL3RA
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16077-1MG
Uniprot ID P26951
Uniprot link P26951
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms IL-3R subunit alpha, IL-3 receptor subunit alpha, CD123, Interleukin-3 receptor subunit alpha, IL3R, IL-3R-alpha, IL3RA, IL-3RA
Reference ARO-A16077
Isotype IgG2, Kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD123/IL3RA
Clone Name SAA0045
Protein Name CD123/IL3RA
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16077-50
Uniprot ID P26951
Uniprot link P26951
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms IL-3R subunit alpha, IL-3 receptor subunit alpha, CD123, Interleukin-3 receptor subunit alpha, IL3R, IL-3R-alpha, IL3RA, IL-3RA
Reference ARO-A16077
Isotype IgG2, Kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD123/IL3RA
Clone Name SAA0045
Protein Name CD123/IL3RA
Target species Anti-Human Monoclonal Antibody

SDS-PAGE for Human CD123/IL3RA Monoclonal Antibody

SDS-PAGE for Human CD123/IL3RA Monoclonal Antibody

Human CD123/IL3RA Monoclonal Antibody, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Human CD123/IL3RA Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD123/IL3RA Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products