Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Talacotuzumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Talacotuzumab ELISA Kit

Talacotuzumab ELISA Kit

Product name Talacotuzumab ELISA Kit
Uniprot ID P26951
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX214
Note For research use only.
Sample type Plasma, Serum
Target Talacotuzumab
Immunogen Talacotuzumab

The Structure of Talacotuzumab ELISA Kit

Talacotuzumab ELISA Kit is a highly sensitive and specific diagnostic tool used for the detection of talacotuzumab, a monoclonal antibody that targets the CD123 protein. The kit is composed of several components, including a microplate coated with a capture antibody, detection antibody, and enzyme-conjugated secondary antibody. The capture antibody is specific for talacotuzumab and is immobilized on the surface of the microplate. The detection antibody is labeled with an enzyme, such as horseradish peroxidase, which produces a colorimetric signal upon binding to the target antibody. This allows for the quantification of talacotuzumab in a sample.

The Activity of Talacotuzumab ELISA Kit

Talacotuzumab is a monoclonal antibody that specifically targets the CD123 protein, which is highly expressed on the surface of leukemic stem cells and leukemic blasts in acute myeloid leukemia (AML). This makes it a promising therapeutic target for the treatment of AML. The Talacotuzumab ELISA Kit utilizes the specific binding of talacotuzumab to CD123 to accurately detect and quantify the antibody in a sample.

The kit has a high sensitivity and specificity, allowing for the detection of even low levels of talacotuzumab in a sample. This is crucial for monitoring the response to talacotuzumab treatment in AML patients, as well as for determining the optimal dosage of the drug. The kit also has a wide dynamic range, ensuring accurate results over a broad range of talacotuzumab concentrations.

The Application of Talacotuzumab ELISA Kit

The Talacotuzumab ELISA Kit has several applications in both research and clinical settings. In research, the kit can be used to study the pharmacokinetics and pharmacodynamics of talacotuzumab, as well as its efficacy in different patient populations. It can also be used to screen for potential biomarkers that may predict response to talacotuzumab treatment.

In clinical settings, the kit is primarily used for the diagnosis and monitoring of AML patients receiving talacotuzumab therapy. It can also be used to assess the level of CD123 expression in AML patients, as well as to determine the potential for talacotuzumab resistance. This information can aid in the development of personalized treatment plans for AML patients.

In addition to its primary application in AML, the Talacotuzumab ELISA Kit may also have potential in other CD123-expressing malignancies, such as acute lymphoblastic leukemia and blastic plasmacytoid dendritic cell neoplasm. Further research is needed to explore these possibilities.

Conclusion

In summary, the Talacotuzumab ELISA Kit is a highly sensitive and specific diagnostic tool for the detection and quantification of talacotuzumab, a monoclonal antibody that targets the CD123 protein. Its accurate and reliable results make it a valuable tool in both research and clinical settings, particularly in the diagnosis and monitoring of AML patients receiving talacotuzumab therapy. With further research, the kit may also have potential applications in other CD123-expressing malignancies.

Talacotuzumab ELISA Kit

There are no reviews yet.

Be the first to review “Talacotuzumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products