S. pombe Swi6 Recombinant Protein

Reference:
Product nameS. pombe Swi6 Recombinant Protein
Uniprot IDP40381
Uniprot linkhttp://www.uniprot.org/uniprot/P40381
Origin speciesS. pombe
Expression systemProcaryotic expression
SequenceMAHNHRHKHKLMKKGGVRSYRRSSTSKRSVIDDDSEPELPSMTKEAIASHKADSGSSDNEVESDHESKSSSKKLKENAKE EEGGEEEEEDEYVVEKVLKHRMARKGGGYEYLLKWEGYDDPSDNTWSSEADCSGCKQLIEAYWNEHGGRPEPSKRKRTAR PKKPEAKEPSPKSRKTDEDKHDKDSNEKIEDVNEKTIKFADKSQEEFNENGPPSGQPNGHIESDNESKSPSQKESNESED IQIAETPSNVTPKKKPSPEVPKLPDNRELTVKQVENYDSWEDLVSSIDTIERKDDGTLEIYLTWKNGAISHHPSTITNKK CPQKMLQFYESHLTFRENE
Molecular weight38,62 kDa
Protein delivered with Tag?Yes
Purity estimated90%
BufferPBS, imidazole 300mM
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeFull-length
Protein AccessionNP_593449.1
Spec:Entrez GeneID2541633
Spec:NCBI Gene AliasesSPAC824.10c
Spec:SwissProtIDP40381
NCBI ReferenceNP_593449.1
Aliases /SynonymsSwi6, chromodomain protein Swi6
ReferencePX-P1157
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “S. pombe Swi6 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.