Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

DNA-binding protein H-NS (hns)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P0ACF9
Molecular weight:
17.63kDa

€210.00

50ug + 210 loyalty points
Met12–Gln156
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
DNA-binding protein H-NS (hns)

DNA-binding protein H-NS (hns)

Product name DNA-binding protein H-NS (hns)
Uniprot ID P0ACF9
Uniprot link https://www.uniprot.org/uniprot/P0ACF9
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGLEVLFQGPMSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQY REMLIADGIDPNELLNSLAAVKSGTKAKRAQRPAKYSYVDENGETKTWTGQGRTPAVIKKAMDEQGKSLDDFLIKQ
Molecular weight 17.63kDa
Purity estimated 40% by SDS-PAGE
Buffer 20 mM Tris HCl, pH 8.0, 2 mM MgCl2, and 20 mM NaCl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met12-Gln156
Aliases /Synonyms DNA-binding protein H-NS, Histone-like protein HLP-II, Protein B1, Protein H1
Reference PX-P4380
Note For research use only
Molecular Constructor
Met12–Gln156
Product name DNA-binding protein H-NS (hns)
Uniprot ID P0ACF9
Uniprot link https://www.uniprot.org/uniprot/P0ACF9
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGLEVLFQGPMSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQY REMLIADGIDPNELLNSLAAVKSGTKAKRAQRPAKYSYVDENGETKTWTGQGRTPAVIKKAMDEQGKSLDDFLIKQ
Molecular weight 17.63kDa
Purity estimated 40% by SDS-PAGE
Buffer 20 mM Tris HCl, pH 8.0, 2 mM MgCl2, and 20 mM NaCl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met12-Gln156
Aliases /Synonyms DNA-binding protein H-NS, Histone-like protein HLP-II, Protein B1, Protein H1
Reference PX-P4380
Note For research use only
Molecular Constructor
Met12–Gln156

There are no reviews yet.

Be the first to review “DNA-binding protein H-NS (hns)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products