Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Thioredoxin 1(trxA)(Shigella flexneri)

Host species:
Escherichia coli (E.coli)
Origin species:
Shigella flexneri
Uniprot ID:
P0AA30
Molecular weight:
12.87kDa

Original price was: €178.00.Current price is: €142.00.

100ug 20% OFF + 142 loyalty points
Met1–Ala109 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Thioredoxin 1(trxA)(Shigella flexneri)

Product name Thioredoxin 1(trxA)(Shigella flexneri)
Uniprot ID P0AA30
Uniprot link https://www.uniprot.org/uniprot/P0AA30
Origin species Shigella flexneri
Expression system Prokaryotic expression
Raw Antigen Sequence MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Molecular weight 12.87kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala109
Protein Accession P0AA30
Spec:Entrez GeneID 1026010
Spec:SwissProtID Q8XAT2
NCBI Reference P0AA30
Aliases /Synonyms Trx-1
Reference PX-P4573
Note For research use only
Molecular Constructor
Met1–Ala109 His
Product name Thioredoxin 1(trxA)(Shigella flexneri)
Uniprot ID P0AA30
Uniprot link https://www.uniprot.org/uniprot/P0AA30
Origin species Shigella flexneri
Expression system Prokaryotic expression
Raw Antigen Sequence MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Molecular weight 12.87kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala109
Protein Accession P0AA30
Spec:Entrez GeneID 1026010
Spec:SwissProtID Q8XAT2
NCBI Reference P0AA30
Aliases /Synonyms Trx-1
Reference PX-P4573
Note For research use only
Molecular Constructor
Met1–Ala109 His
Product name PX-P4573-1MG
Uniprot ID P0AA30
Uniprot link https://www.uniprot.org/uniprot/P0AA30
Origin species Shigella flexneri
Expression system Prokaryotic expression
Raw Antigen Sequence MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Molecular weight 12.87kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala109
Protein Accession P0AA30
Spec:Entrez GeneID 1026010
Spec:SwissProtID Q8XAT2
NCBI Reference P0AA30
Aliases /Synonyms Trx-1
Reference PX-P4573
Note For research use only
Molecular Constructor
Met1–Ala109 His

Thioredoxin 1(trxA)(Shigella flexneri)

There are no reviews yet.

Be the first to review “Thioredoxin 1(trxA)(Shigella flexneri)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products