Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Otogelin-like protein(Otogl)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
F7A4A7
Molecular weight:
25.90kDa

Original price was: €246.00.Current price is: €210.00.

50ug 15% OFF + 210 loyalty points
Arg1507–Lys1727
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Otogelin-like protein(Otogl)

Product name Otogelin-like protein(Otogl)
Uniprot ID F7A4A7
Uniprot link http://www.uniprot.org/uniprot/F7A4A7
Expression system Prokaryotic expression
Raw Antigen Sequence RCSMLSELSIITFDGNSAALSSMASYILVRVPGEIVVVHIDKCSMNQNGHALKKPASFGRISGLCFKKLNVTTSIHKILINRVVRKVDVDSIVVPLPFSSHELFIEDSGTMYVITTPAGLIIKWAHLTGIIDIHFGPQFNLSSYTEGLCGICNDNPDDDLRMQNGTIITNMEDIELFIGSWEIEKSFEVTMRRPVRNCTEYDCSHCIELLNREGFIPCHDK
Molecular weight 25.90kDa
Purity estimated 50% by SDS-PAGE
Buffer PBS, pH7.5, 4M urea
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg1507-Lys1727
Reference PX-P4536
Note For research use only
Molecular Constructor
Arg1507–Lys1727
Product name Otogelin-like protein(Otogl)
Uniprot ID F7A4A7
Uniprot link http://www.uniprot.org/uniprot/F7A4A7
Expression system Prokaryotic expression
Raw Antigen Sequence RCSMLSELSIITFDGNSAALSSMASYILVRVPGEIVVVHIDKCSMNQNGHALKKPASFGRISGLCFKKLNVTTSIHKILINRVVRKVDVDSIVVPLPFSSHELFIEDSGTMYVITTPAGLIIKWAHLTGIIDIHFGPQFNLSSYTEGLCGICNDNPDDDLRMQNGTIITNMEDIELFIGSWEIEKSFEVTMRRPVRNCTEYDCSHCIELLNREGFIPCHDK
Molecular weight 25.90kDa
Purity estimated 50% by SDS-PAGE
Buffer PBS, pH7.5, 4M urea
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg1507-Lys1727
Reference PX-P4536
Note For research use only
Molecular Constructor
Arg1507–Lys1727
Product name PX-P4536-1MG
Uniprot ID F7A4A7
Uniprot link http://www.uniprot.org/uniprot/F7A4A7
Expression system Prokaryotic expression
Raw Antigen Sequence RCSMLSELSIITFDGNSAALSSMASYILVRVPGEIVVVHIDKCSMNQNGHALKKPASFGRISGLCFKKLNVTTSIHKILINRVVRKVDVDSIVVPLPFSSHELFIEDSGTMYVITTPAGLIIKWAHLTGIIDIHFGPQFNLSSYTEGLCGICNDNPDDDLRMQNGTIITNMEDIELFIGSWEIEKSFEVTMRRPVRNCTEYDCSHCIELLNREGFIPCHDK
Molecular weight 25.90kDa
Purity estimated 50% by SDS-PAGE
Buffer PBS, pH7.5, 4M urea
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg1507-Lys1727
Reference PX-P4536
Note For research use only
Molecular Constructor
Arg1507–Lys1727

Otogelin-like protein(Otogl)

There are no reviews yet.

Be the first to review “Otogelin-like protein(Otogl)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products