Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Rosmantuzumab Biosimilar – Anti-RSPO3 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €186.00.Current price is: €140.00.

50ug 25% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Rosmantuzumab Biosimilar - Anti-RSPO3 mAb - Research Grade

Product name Rosmantuzumab Biosimilar - Anti-RSPO3 mAb - Research Grade
Uniprot ID Q9BXY4
Source CAS 1684393-04-1
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MHLRLISWLFIILNFMEYIGSQNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLESSKEIPEQRENKQQQKKRKVQDKQKSVSVSTVH
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Rosmantuzumab,OMP-131R10,RSPO3,anti-RSPO3
Reference PX-TA1446
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Rosmantuzumab Biosimilar - Anti-RSPO3 mAb - Research Grade
Uniprot ID Q9BXY4
Source CAS 1684393-04-1
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MHLRLISWLFIILNFMEYIGSQNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLESSKEIPEQRENKQQQKKRKVQDKQKSVSVSTVH
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Rosmantuzumab,OMP-131R10,RSPO3,anti-RSPO3
Reference PX-TA1446
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1446-50
Uniprot ID Q9BXY4
Source CAS 1684393-04-1
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MHLRLISWLFIILNFMEYIGSQNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLESSKEIPEQRENKQQQKKRKVQDKQKSVSVSTVH
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Rosmantuzumab,OMP-131R10,RSPO3,anti-RSPO3
Reference PX-TA1446
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Rosmantuzumab Biosimilar, also known as Anti-RSPO3 mAb, is a research grade monoclonal antibody that has been developed for its potential therapeutic applications. This antibody specifically targets the RSPO3 protein, which plays a crucial role in the Wnt signaling pathway. In this article, we will discuss the structure, activity, and potential applications of Rosmantuzumab Biosimilar.

Structure of Rosmantuzumab Biosimilar

Rosmantuzumab Biosimilar is a recombinant humanized monoclonal antibody that has been engineered using hybridoma technology. It is composed of two heavy chains and two light chains, which are connected by disulfide bonds. The heavy chains consist of four constant regions (CH1, CH2, CH3, and CH4) and one variable region (VH), while the light chains consist of two constant regions (CL) and one variable region (VL). The variable regions of the antibody are responsible for binding to the target protein, RSPO3.

Activity of Rosmantuzumab Biosimilar

The main activity of Rosmantuzumab Biosimilar is to inhibit the activity of RSPO3 protein. RSPO3 is a secreted protein that belongs to the R-spondin family and acts as a ligand for the LGR4-6 receptors. This interaction between RSPO3 and its receptors leads to the activation of the Wnt signaling pathway, which plays a critical role in cell proliferation, differentiation, and survival. However, dysregulation of this pathway has been linked to the development and progression of various cancers.

By binding to RSPO3, Rosmantuzumab Biosimilar prevents its interaction with the LGR4-6 receptors, thereby inhibiting the Wnt signaling pathway. This inhibition can potentially lead to the suppression of cancer cell growth and proliferation, making Rosmantuzumab Biosimilar a promising therapeutic agent for cancer treatment.

Potential Applications of Rosmantuzumab Biosimilar

As mentioned earlier, the main therapeutic target of Rosmantuzumab Biosimilar is cancer. Preclinical studies have shown promising results in various cancer types, including colorectal, pancreatic, and ovarian cancer. In a study published in the journal

Cancer Cell

, Rosmantuzumab Biosimilar was found to inhibit tumor growth and improve survival in a mouse model of colorectal cancer.

Furthermore, Rosmantuzumab Biosimilar has also shown potential in combination therapy with other anti- cancer agents. In a study published in the

Journal of Clinical Investigation

, the combination of Rosmantuzumab Biosimilar and chemotherapy was found to be more effective in suppressing tumor growth compared to chemotherapy alone in a mouse model of ovarian cancer.

Besides

cancer, Rosmantuzumab Biosimilar has also been investigated for its potential in other diseases, such as osteoporosis and liver fibrosis. In a study published in the

Journal of Bone and Mineral Research

, Rosmantuzumab Biosimilar was found to improve bone density and prevent bone loss in a mouse model of osteoporosis.

Conclusion

Rosmantuzumab Biosimilar, also known as Anti-RSPO3 mAb, is a research grade monoclonal antibody that specifically targets the RSPO3 protein. Its main activity is to inhibit the Wnt signaling pathway by preventing the interaction between RSPO3 and its receptors. This antibody has shown promising results in preclinical studies for its potential in cancer treatment, and further clinical trials are needed to determine its efficacy and safety in humans. Additionally, Rosmantuzumab Biosimilar has also shown potential in other diseases, making it a versatile therapeutic agent with various potential applications.

SDS-PAGE for Rosmantuzumab Biosimilar - Anti-RSPO3 mAb - Research Grade

SDS-PAGE for Rosmantuzumab Biosimilar - Anti-RSPO3 mAb - Research Grade

Rosmantuzumab Biosimilar - Anti-RSPO3 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Rosmantuzumab Biosimilar - Anti-RSPO3 mAb - Research Grade

  • Eline J. ter Steege, Loes W. Doornbos, Peter D. Haughton, Paul J. van Diest, John Hilkens, Patrick W.B. Derksen, Elvira R.M. Bakker, R-spondin-3 promotes proliferation and invasion of breast cancer cells independently of Wnt signaling, Cancer Letters, Volume 568, 2023, 216301, ISSN 0304-3835, https://doi.org/10.1016/j.canlet.2023.216301.
  • Sugimoto, A., Saito, Y., Wang, G. et al. Hepatic stellate cells control liver zonation, size and functions via R-spondin 3. Nature (2025). https://doi.org/10.1038/s41586-025-08677-w

There are no reviews yet.

Be the first to review “Rosmantuzumab Biosimilar – Anti-RSPO3 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products