Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Umesolerbart Biosimilar – Anti-BETVIA mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: €195.00.Current price is: €140.00.

50ug 28% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Umesolerbart Biosimilar - Anti-BETVIA mAb - Research Grade

Product name Umesolerbart Biosimilar - Anti-BETVIA mAb - Research Grade
Uniprot ID P15494
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-BETVIA, Major pollen allergen Bet v 1-A, Allergen Bet v I-A, Bet v 1-A, BETVI
Reference PX-TA2047
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Umesolerbart Biosimilar - Anti-BETVIA mAb - Research Grade
Uniprot ID P15494
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-BETVIA, Major pollen allergen Bet v 1-A, Allergen Bet v I-A, Bet v 1-A, BETVI
Reference PX-TA2047
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA2047-50
Uniprot ID P15494
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-BETVIA, Major pollen allergen Bet v 1-A, Allergen Bet v I-A, Bet v 1-A, BETVI
Reference PX-TA2047
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

The Structure and Function of Umesolerbart Biosimilar – Anti-BETVIA mAb – Research Grade The

Structure of Umesolerbart Biosimilar

Umesolerbart Biosimilar is a monoclonal antibody (mAb) that has been developed as a biosimilar to the therapeutic antibody BETVIA. It is a research grade antibody that has been designed to target and bind to BETVIA, a protein that is involved in various inflammatory and autoimmune diseases.

The structure of Umesolerbart Biosimilar is similar to that of BETVIA, as it is a monoclonal antibody that is composed of two heavy chains and two light chains. These chains are connected by disulfide bonds and form a Y-shaped structure. The variable regions of the antibody, which are responsible for binding to BETVIA, are located at the tips of the Y-shaped structure.

The Activity of Umesolerbart Biosimilar

Umesolerbart Biosimilar has been specifically designed to bind to BETVIA with high affinity and specificity. This means that it has a strong and specific interaction with BETVIA, which allows it to effectively inhibit its activity.

BETVIA is a cytokine that plays a crucial role in the regulation of immune responses. It has been implicated in the development of various inflammatory and autoimmune diseases, such as rheumatoid arthritis, psoriasis, and multiple sclerosis. By targeting and binding to BETVIA, Umesolerbart Biosimilar is able to block its activity and prevent it from causing inflammation and damage in the body.

The Application of Umesolerbart Biosimilar

Umesolerbart Biosimilar has a wide range of potential applications in the field of immunology and therapeutics. Its ability to specifically target and inhibit BETVIA makes it a promising candidate for the treatment of various inflammatory and autoimmune diseases.

In pre-clinical studies, Umesolerbart Biosimilar has shown promising results in reducing inflammation and disease progression in animal models of rheumatoid arthritis and psoriasis. It has also been shown to be effective in suppressing the immune response in models of multiple sclerosis.

Furthermore, Umesolerbart Biosimilar has the potential to be used in combination with other therapies to enhance their effectiveness. For example, it could be used in combination with traditional disease-modifying antirheumatic drugs (DMARDs) in the treatment of rheumatoid arthritis.

Conclusion

In summary, Umesolerbart Biosimilar is a research grade monoclonal antibody that has been developed as a biosimilar to the therapeutic antibody BETVIA. Its structure is similar to BETVIA, and it has been designed to specifically target and bind to BETVIA with high affinity and specificity. Its potential applications in the treatment of inflammatory and autoimmune diseases make it a promising candidate for further research and development.

SDS-PAGE for Umesolerbart Biosimilar - Anti-BETVIA mAb - Research Grade

SDS-PAGE for Umesolerbart Biosimilar - Anti-BETVIA mAb - Research Grade

Umesolerbart Biosimilar - Anti-BETVIA mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Umesolerbart Biosimilar - Anti-BETVIA mAb - Research Grade

There are no reviews yet.

Be the first to review “Umesolerbart Biosimilar – Anti-BETVIA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products