Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Romosozumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Romosozumab ELISA Kit

Romosozumab ELISA Kit

Product name Romosozumab ELISA Kit
Uniprot ID Q9BQB4
Raw Antigen Sequence MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX275
Note For research use only.
Sample type Plasma, Serum
Target Romosozumab
Immunogen Romosozumab

The Structure and Function of Romosozumab ELISA Kit Introduction

Romosozumab is a monoclonal antibody that has been approved by the FDA for the treatment of osteoporosis in postmenopausal women. It works by inhibiting the activity of a protein called sclerostin, which plays a key role in the regulation of bone formation and resorption. The Romosozumab ELISA Kit is a powerful tool used by researchers to measure the levels of this antibody in various biological samples. In this article, we will delve into the structure, activity, and applications of this kit in detail.

Structure of Romosozumab ELISA Kit

The Romosozumab ELISA Kit is composed of several components that work together to accurately measure the levels of Romosozumab in a sample. The main components of the kit include:

1. Microplate The microplate is a 96-well plate that is coated with a specific antibody that binds to Romosozumab. This coating ensures that only Romosozumab present in the sample will be captured by the plate, while other proteins and molecules will be washed away.

2. Romosozumab Standard The Romosozumab Standard is a known concentration of Romosozumab that is included in the kit. This standard is used to create a standard curve, which is used to determine the concentration of Romosozumab in the sample.

3. Romosozumab Detection Antibody The Romosozumab Detection Antibody is a biotinylated antibody that specifically binds to Romosozumab. This antibody is used to detect the captured Romosozumab on the microplate.

4. Streptavidin-HRP Conjugate The Streptavidin-HRP Conjugate is an enzyme that binds to the biotinylated Romosozumab Detection Antibody. This enzyme catalyzes a reaction that produces a color change, which can be measured and used to determine the concentration of Romosozumab in the sample.

5. Substrate Solution The Substrate Solution is a solution that is added to the microplate after the Streptavidin-HRP Conjugate. This solution reacts with the enzyme and produces a color change that is directly proportional to the amount of Romosozumab present in the sample.

Activity of Romosozumab ELISA Kit

The Romosozumab ELISA Kit works on the principle of the enzyme-linked immunosorbent assay (ELISA). The microplate is first coated with a specific antibody that binds to Romosozumab. When a sample containing Romosozumab is added to the plate, the Romosozumab binds to the immobilized antibody. After washing away any unbound proteins and molecules, the Romosozumab Detection Antibody is added, followed by the Streptavidin-HRP Conjugate and Substrate Solution. The color change produced by the reaction between the enzyme and substrate is then measured using a spectrophotometer, and the Romosozumab concentration in the sample is determined using the standard curve.

Applications of Romosozumab ELISA Kit

The Romosozumab ELISA Kit has several applications in the field of research and drug development. Some of the key applications include:

1. Quantification of Romosozumab in Biological Samples The Romosozumab ELISA Kit is primarily used to measure the levels of Romosozumab in various biological samples, such as serum, plasma, and cell culture supernatants. This allows researchers to monitor the effectiveness of Romosozumab treatment and study its pharmacokinetics.

2. Screening of Potential Therapeutic Targets

Romosozumab ELISA Kit

There are no reviews yet.

Be the first to review “Romosozumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products