Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Nipah virus/HeV F/Fusion glycoprotein F0 Protein, N-His, N-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Nipah virus(HeV)
Uniprot ID:
Q9IH63
Molecular weight:
23.21 kDa

Original price was: €262.00.Current price is: €230.00.

50ug 12% OFF + 230 loyalty points
Ile27–Gly112
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Nipah virus/HeV F/Fusion glycoprotein F0 Protein, N-His, N-SUMO & C-Strep

Product name ARO-P12725-100
Uniprot ID Q9IH63
Origin species Nipah virus(HeV)
Expression system Prokaryotic expression
Raw Antigen Sequence ILHYEKLSKIGLVKGVTRKYKIKSNPLTKDIVIKMIPNVSNMSQCTGSVMENYKTRLNGILTPIKGALEIYKNNTHDLVGDVRLAG
Molecular weight 23.21 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile27-Gly112
Aliases /Synonyms Fusion glycoprotein F0, Protein F, Fusion glycoprotein F2, Fusion glycoprotein F1, F, Nipah Virus (NiV) / Hendra Virus (HeV)
Reference ARO-P12725
Note For research use only.
Molecular Constructor
Ile27–Gly112
Product name ARO-P12725-1MG
Uniprot ID Q9IH63
Origin species Nipah virus(HeV)
Expression system Prokaryotic expression
Raw Antigen Sequence ILHYEKLSKIGLVKGVTRKYKIKSNPLTKDIVIKMIPNVSNMSQCTGSVMENYKTRLNGILTPIKGALEIYKNNTHDLVGDVRLAG
Molecular weight 23.21 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile27-Gly112
Aliases /Synonyms Fusion glycoprotein F0, Protein F, Fusion glycoprotein F2, Fusion glycoprotein F1, F, Nipah Virus (NiV) / Hendra Virus (HeV)
Reference ARO-P12725
Note For research use only.
Molecular Constructor
Ile27–Gly112
Product name ARO-P12725-50
Uniprot ID Q9IH63
Origin species Nipah virus(HeV)
Expression system Prokaryotic expression
Raw Antigen Sequence ILHYEKLSKIGLVKGVTRKYKIKSNPLTKDIVIKMIPNVSNMSQCTGSVMENYKTRLNGILTPIKGALEIYKNNTHDLVGDVRLAG
Molecular weight 23.21 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile27-Gly112
Aliases /Synonyms Fusion glycoprotein F0, Protein F, Fusion glycoprotein F2, Fusion glycoprotein F1, F, Nipah Virus (NiV) / Hendra Virus (HeV)
Reference ARO-P12725
Note For research use only.
Molecular Constructor
Ile27–Gly112

Recombinant Nipah virus/HeV F/Fusion glycoprotein F0 Protein, N-His, N-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Nipah virus/HeV F/Fusion glycoprotein F0 Protein, N-His, N-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products