Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Streptavidin

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P22629
Molecular weight:
18.79kDa

69.00

50ug + 69 loyalty points
His Asp25–Gln183
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Streptavidin

Product name Streptavidin
Uniprot ID P22629
Uniprot link https://www.uniprot.org/uniprot/P22629
Expression system Prokaryotic expression
Raw Antigen Sequence MGSSHHHHHHSSGLVPRGSHMDPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
Molecular weight 18.79kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp25-Gln183
Protein Accession P22629
NCBI Reference P22629
Aliases /Synonyms Streptavidin
Reference PX-P4756
Note For research use only
Molecular Constructor
His Asp25–Gln183
Product name Streptavidin
Uniprot ID P22629
Uniprot link https://www.uniprot.org/uniprot/P22629
Expression system Prokaryotic expression
Raw Antigen Sequence MGSSHHHHHHSSGLVPRGSHMDPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
Molecular weight 18.79kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp25-Gln183
Protein Accession P22629
NCBI Reference P22629
Aliases /Synonyms Streptavidin
Reference PX-P4756
Note For research use only
Molecular Constructor
His Asp25–Gln183

There are no reviews yet.

Be the first to review “Streptavidin”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products