Tumor necrosis factor receptor superfamily member 6(FAS) (Gln26-Asn173)

Reference:
Product nameTumor necrosis factor receptor superfamily member 6(FAS) (Gln26-Asn173)
Uniprot IDP25445
Uniprot linkhttps://www.uniprot.org/uniprot/P25445
Origin speciesHomo sapiens (Human)
Expression systemProcaryotic expression
SequenceQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHF SSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEG SRSN
Molecular weight16.64 kDa
Protein delivered with Tag?N-terminal His Tag
Purity estimated>90% by SDS-PAGE
BufferPBS pH 7.5
Delivery conditionDry Ice
Delivery lead time in business daysEurope: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeGln26-Asn173
Protein AccessionP25445
Spec:Entrez GeneID355
Spec:NCBI Gene AliasesAPT1; CD95; FAS1; APO-1; FASTM; ALPS1A; TNFRSF6
Spec:SwissProtIDQ6SSE9
NCBI ReferenceP25445
Aliases /SynonymsAPT1, FAS1, TNFRSF6,Apo-1 antigen,Apoptosis-mediating surface antigen FAS,FASLG receptor, CD95
ReferencePX-P4778
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Tumor necrosis factor receptor superfamily member 6(FAS) (Gln26-Asn173)”

Your email address will not be published. Required fields are marked *

Related products

Stable Istotope Labelled Fasinumab Biosimilar – Anti-NGF/NGFB  mAb – Research Grade
Biosimilar Stable Istotope Labelled Fasinumab Biosimilar – Anti-NGF/NGFB mAb – Research Grade PX-TA1292-SIL 1500€
Stable Istotope Labelled Lifastuzumab Biosimilar – Anti-SLC34A2 mAb – Research Grade
Biosimilar Stable Istotope Labelled Lifastuzumab Biosimilar – Anti-SLC34A2 mAb – Research Grade PX-TA1334-SIL 1500€
Stable Isotope Labeled Tafasitamab Biosimilar – Anti-CD19 mAb – Research Grade
Biosimilar Stable Isotope Labeled Tafasitamab Biosimilar – Anti-CD19 mAb – Research Grade PX-TA1365-SIL 1500€
Stable Istotope Labelled Afasevikumab Biosimilar – Anti-IL17A /IL17F mAb – Research Grade
Biosimilar Stable Istotope Labelled Afasevikumab Biosimilar – Anti-IL17A /IL17F mAb – Research Grade PX-TA1401-SIL 1500€
Stable Isotope Labeled Tafasitamab Biosimilar – Anti-CD19 mAb – Research Grade
SIL Stable Isotope Labeled Tafasitamab Biosimilar – Anti-CD19 mAb – Research Grade PX-TA1365-SIL 1500€
Tumor necrosis factor receptor superfamily member 6(FAS) (Gln26-Asn173)
Ligand Tumor necrosis factor receptor superfamily member 6(FAS) (Gln26-Asn173) PX-P4778 108€

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.







    X