Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Tumor necrosis factor receptor superfamily member 6(FAS) (Gln26-Asn173)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P25445
Molecular weight:
16.64 kDa

€142.00

100ug + 142 loyalty points
His Gln26–Asn173
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Tumor necrosis factor receptor superfamily member 6(FAS) (Gln26-Asn173)

Tumor necrosis factor receptor superfamily member 6(FAS) (Gln26-Asn173)

Product name Tumor necrosis factor receptor superfamily member 6(FAS) (Gln26-Asn173)
Uniprot ID P25445
Uniprot link https://www.uniprot.org/uniprot/P25445
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHF SSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEG SRSN
Molecular weight 16.64 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln26-Asn173
Protein Accession P25445
Spec:Entrez GeneID 355
Spec:NCBI Gene Aliases APT1; CD95; FAS1; APO-1; FASTM; ALPS1A; TNFRSF6
Spec:SwissProtID Q6SSE9
NCBI Reference P25445
Aliases /Synonyms APT1, FAS1, TNFRSF6,Apo-1 antigen,Apoptosis-mediating surface antigen FAS,FASLG receptor, CD95
Reference PX-P4778
Note For research use only
Molecular Constructor
His Gln26–Asn173
Product name Tumor necrosis factor receptor superfamily member 6(FAS) (Gln26-Asn173)
Uniprot ID P25445
Uniprot link https://www.uniprot.org/uniprot/P25445
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHF SSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEG SRSN
Molecular weight 16.64 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln26-Asn173
Protein Accession P25445
Spec:Entrez GeneID 355
Spec:NCBI Gene Aliases APT1; CD95; FAS1; APO-1; FASTM; ALPS1A; TNFRSF6
Spec:SwissProtID Q6SSE9
NCBI Reference P25445
Aliases /Synonyms APT1, FAS1, TNFRSF6,Apo-1 antigen,Apoptosis-mediating surface antigen FAS,FASLG receptor, CD95
Reference PX-P4778
Note For research use only
Molecular Constructor
His Gln26–Asn173

There are no reviews yet.

Be the first to review “Tumor necrosis factor receptor superfamily member 6(FAS) (Gln26-Asn173)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products