Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Mouse CX3CL1/Fractalkine Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
O35188
Molecular weight:
19.51 kDa

Original price was: €258.00.Current price is: €230.00.

50ug 11% OFF + 230 loyalty points
Thr40–Lys102
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant Mouse CX3CL1/Fractalkine Protein, N-His-SUMO

Recombinant Mouse CX3CL1/Fractalkine Protein, N-His-SUMO

Product name ARO-P10635-100
Uniprot ID O35188
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TSRIPVALLIRYQLNQESCGKRAIVLETTQHRRFCADPKEKWVQDAMKHLDHQAAALTKNGGK
Molecular weight 19.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr40-Lys102
Aliases /Synonyms Small-inducible cytokine D1, Fractalkine, Neurotactin, C-X3-C motif chemokine 1, NTT, CX3CL1, SCYD1, FKN, CX3C membrane-anchored chemokine
Reference ARO-P10635
Note For research use only.
Molecular Constructor
Thr40–Lys102
Product name ARO-P10635-1MG
Uniprot ID O35188
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TSRIPVALLIRYQLNQESCGKRAIVLETTQHRRFCADPKEKWVQDAMKHLDHQAAALTKNGGK
Molecular weight 19.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr40-Lys102
Aliases /Synonyms Small-inducible cytokine D1, Fractalkine, Neurotactin, C-X3-C motif chemokine 1, NTT, CX3CL1, SCYD1, FKN, CX3C membrane-anchored chemokine
Reference ARO-P10635
Note For research use only.
Molecular Constructor
Thr40–Lys102
Product name ARO-P10635-50
Uniprot ID O35188
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TSRIPVALLIRYQLNQESCGKRAIVLETTQHRRFCADPKEKWVQDAMKHLDHQAAALTKNGGK
Molecular weight 19.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr40-Lys102
Aliases /Synonyms Small-inducible cytokine D1, Fractalkine, Neurotactin, C-X3-C motif chemokine 1, NTT, CX3CL1, SCYD1, FKN, CX3C membrane-anchored chemokine
Reference ARO-P10635
Note For research use only.
Molecular Constructor
Thr40–Lys102

Recombinant Mouse CX3CL1/Fractalkine Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Mouse CX3CL1/Fractalkine Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products