Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CDH3/P-cadherin Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P10287
Molecular weight:
25.28 kDa

Original price was: €285.00.Current price is: €230.00.

50ug 19% OFF + 230 loyalty points
Met103–Ala313
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CDH3/P-cadherin Protein, N-His

Product name ARO-P10498-100
Uniprot ID P10287
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MPPIFVPENGKGPFPQRLNQLKSNKDRGTKIFYSITGPGADSPPEGVFTIEKESGWLLLHMPLDREKIVKYELYGHAVSENGASVEEPMNISIIVTDQNDNKPKFTQDTFRGSVLEGVMPGTSVMQVTATDEDDAVNTYNGVVAYSIHSQEPKEPHDLMFTIHKSTGTISVISSGLDREKVPEYRLTVQATDMDGEGSTTTAEAVVQILDA
Molecular weight 25.28 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met103-Ala313
Aliases /Synonyms Placental cadherin, CDH3, Cadherin-3, P-cadherin, CDHP
Reference ARO-P10498
Note For research use only.
Molecular Constructor
Met103–Ala313
Product name ARO-P10498-1MG
Uniprot ID P10287
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MPPIFVPENGKGPFPQRLNQLKSNKDRGTKIFYSITGPGADSPPEGVFTIEKESGWLLLHMPLDREKIVKYELYGHAVSENGASVEEPMNISIIVTDQNDNKPKFTQDTFRGSVLEGVMPGTSVMQVTATDEDDAVNTYNGVVAYSIHSQEPKEPHDLMFTIHKSTGTISVISSGLDREKVPEYRLTVQATDMDGEGSTTTAEAVVQILDA
Molecular weight 25.28 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met103-Ala313
Aliases /Synonyms Placental cadherin, CDH3, Cadherin-3, P-cadherin, CDHP
Reference ARO-P10498
Note For research use only.
Molecular Constructor
Met103–Ala313
Product name ARO-P10498-50
Uniprot ID P10287
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MPPIFVPENGKGPFPQRLNQLKSNKDRGTKIFYSITGPGADSPPEGVFTIEKESGWLLLHMPLDREKIVKYELYGHAVSENGASVEEPMNISIIVTDQNDNKPKFTQDTFRGSVLEGVMPGTSVMQVTATDEDDAVNTYNGVVAYSIHSQEPKEPHDLMFTIHKSTGTISVISSGLDREKVPEYRLTVQATDMDGEGSTTTAEAVVQILDA
Molecular weight 25.28 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met103-Ala313
Aliases /Synonyms Placental cadherin, CDH3, Cadherin-3, P-cadherin, CDHP
Reference ARO-P10498
Note For research use only.
Molecular Constructor
Met103–Ala313

Introduction

Recombinant Mouse CDH3/P-cadherin Protein is a highly purified and bioactive protein that plays a crucial role in cell adhesion and tissue development. This protein is produced through recombinant DNA technology, making it a valuable tool for various research and therapeutic applications.

Structure of Recombinant Mouse CDH3/P-cadherin Protein

The CDH3 gene encodes for the P-cadherin protein, which is a member of the cadherin superfamily of calcium-dependent cell adhesion molecules. The recombinant protein is a single-chain glycoprotein with a molecular weight of approximately 120 kDa. It consists of five extracellular domains, a transmembrane domain, and a cytoplasmic domain.

The extracellular domains of P-cadherin contain calcium-binding sites, which are essential for its adhesive function. The cytoplasmic domain interacts with cytoplasmic proteins, such as catenins, to mediate cell signaling and adhesion.

Activity of Recombinant Mouse CDH3/P-cadherin Protein

The primary function of P-cadherin is to mediate cell-cell adhesion, which is crucial for tissue development and maintenance. It does so by binding to other cadherin molecules on adjacent cells, forming strong and stable cell-cell contacts. This adhesion is calcium-dependent and can be modulated by various factors, including growth factors and cytokines.

Aside from its adhesive function, P-cadherin also plays a role in cell signaling. The cytoplasmic domain of P-cadherin interacts with intracellular proteins, such as catenins, to regulate various signaling pathways. These pathways are involved in cell proliferation, differentiation, and migration, making P-cadherin a crucial player in tissue development and homeostasis.

Application of Recombinant Mouse CDH3/P-cadherin Protein

Recombinant Mouse CDH3/P-cadherin Protein has a wide range of applications in both research and therapeutic settings. Some of these include:

1. Cell Adhesion Studies

As a key player in cell adhesion, P-cadherin is often used in studies to understand the mechanisms of cell-cell interactions. Recombinant P-cadherin protein can be used to study its binding properties, as well as its role in cell signaling and tissue development.

2. Tissue Engineering

Recombinant P-cadherin protein has been used in tissue engineering to promote cell adhesion and tissue formation. It can be incorporated into scaffolds or matrices to enhance cell attachment and growth, making it a valuable tool in regenerative medicine.

3. Cancer Research

Aberrant expression of P-cadherin has been linked to various cancers, including breast, ovarian, and prostate cancer. Recombinant P-cadherin protein can be used to study its role in cancer development and progression, as well as a potential target for cancer therapy.

4. Antibody Production

Recombinant P-cadherin protein can be used as an antigen to produce specific antibodies for research and diagnostic purposes. These antibodies can be used to detect P-cadherin expression in tissues and cells, providing valuable insights into its role in various biological processes.

5. Therapeutic Applications

Due to its role in tissue development and homeostasis, P-cadherin has been explored as a potential therapeutic target for various diseases. Recombinant P-cadherin protein can be used to develop drugs that modulate its activity

Recombinant Mouse CDH3/P-cadherin Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CDH3/P-cadherin Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products