Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD300b/CD300LB Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q3U497
Molecular weight:
44.22 kDa

Original price was: €230.00.Current price is: €193.00.

50ug 16% OFF + 193 loyalty points
Ser17–Tyr157
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD300b/CD300LB Protein, N-GST & C-His

Product name ARO-P10551-100
Uniprot ID Q3U497
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SIQGPALVRGPEQGSVTVQCRYSSRWQTNKKWWCRGASWSTCRVLIRSTGSEKETKSGRLSIRDNQKNHSFQVTMEMLRQNDTDTYWCGIEKFGTDRGTRVKVNVYSVGKDTMSTSNQLPWPTVDGSTDMVSSDLQKRTYY
Molecular weight 44.22 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser17-Tyr157
Aliases /Synonyms IREM-3, CLM-7, Leukocyte mono-Ig-like receptor 5, CD300b, Immune receptor expressed on myeloid cells 3, CD300LB, CD300B, Triggering receptor expressed on myeloid cells 5, CMRF35-like molecule 7, LMIR5, CMRF35A2, IREM3, CD300 antigen-like family member B, CMRF35-A2, TREM-5, TREM5, CLM7
Reference ARO-P10551
Note For research use only.
Molecular Constructor
Ser17–Tyr157
Product name ARO-P10551-1MG
Uniprot ID Q3U497
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SIQGPALVRGPEQGSVTVQCRYSSRWQTNKKWWCRGASWSTCRVLIRSTGSEKETKSGRLSIRDNQKNHSFQVTMEMLRQNDTDTYWCGIEKFGTDRGTRVKVNVYSVGKDTMSTSNQLPWPTVDGSTDMVSSDLQKRTYY
Molecular weight 44.22 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser17-Tyr157
Aliases /Synonyms IREM-3, CLM-7, Leukocyte mono-Ig-like receptor 5, CD300b, Immune receptor expressed on myeloid cells 3, CD300LB, CD300B, Triggering receptor expressed on myeloid cells 5, CMRF35-like molecule 7, LMIR5, CMRF35A2, IREM3, CD300 antigen-like family member B, CMRF35-A2, TREM-5, TREM5, CLM7
Reference ARO-P10551
Note For research use only.
Molecular Constructor
Ser17–Tyr157
Product name ARO-P10551-50
Uniprot ID Q3U497
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SIQGPALVRGPEQGSVTVQCRYSSRWQTNKKWWCRGASWSTCRVLIRSTGSEKETKSGRLSIRDNQKNHSFQVTMEMLRQNDTDTYWCGIEKFGTDRGTRVKVNVYSVGKDTMSTSNQLPWPTVDGSTDMVSSDLQKRTYY
Molecular weight 44.22 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser17-Tyr157
Aliases /Synonyms IREM-3, CLM-7, Leukocyte mono-Ig-like receptor 5, CD300b, Immune receptor expressed on myeloid cells 3, CD300LB, CD300B, Triggering receptor expressed on myeloid cells 5, CMRF35-like molecule 7, LMIR5, CMRF35A2, IREM3, CD300 antigen-like family member B, CMRF35-A2, TREM-5, TREM5, CLM7
Reference ARO-P10551
Note For research use only.
Molecular Constructor
Ser17–Tyr157

Recombinant Mouse CD300b/CD300LB Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD300b/CD300LB Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products