Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD125/IL5RA Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P21183
Molecular weight:
36.14 kDa

Original price was: €294.00.Current price is: €230.00.

50ug 22% OFF + 230 loyalty points
Asn32–Gly329
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD125/IL5RA Protein, N-His

Product name ARO-P10601-100
Uniprot ID P21183
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence NFTIKATGLAQVLLHWDPNPDQEQRHVDLEYHVKINAPQEDEYDTRKTESKCVTPLHEGFAASVRTILKSSHTTLASSWVSAELKAPPGSPGTSVTNLTCTTHTVVSSHTHLRPYQVSLRCTWLVGKDAPEDTQYFLYYRFGVLTEKCQEYSRDALNRNTACWFPRTFINSKGFEQLAVHINGSSKRAAIKPFDQLFSPLAIDQVNPPRNVTVEIESNSLYIQWEKPLSAFPDHCFNYELKIYNTKNGHIQKEKLIANKFISKIDDVSTYSIQVRAAVSSPCRMPGRWGEWSQPIYVG
Molecular weight 36.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn32-Gly329
Aliases /Synonyms IL-5R subunit alpha, IL-5 receptor subunit alpha, IL5RA, IL-5RA, IL-5R-alpha, Interleukin-5 receptor subunit alpha, CDw125, CD125, IL5R
Reference ARO-P10601
Note For research use only.
Molecular Constructor
Asn32–Gly329
Product name ARO-P10601-1MG
Uniprot ID P21183
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence NFTIKATGLAQVLLHWDPNPDQEQRHVDLEYHVKINAPQEDEYDTRKTESKCVTPLHEGFAASVRTILKSSHTTLASSWVSAELKAPPGSPGTSVTNLTCTTHTVVSSHTHLRPYQVSLRCTWLVGKDAPEDTQYFLYYRFGVLTEKCQEYSRDALNRNTACWFPRTFINSKGFEQLAVHINGSSKRAAIKPFDQLFSPLAIDQVNPPRNVTVEIESNSLYIQWEKPLSAFPDHCFNYELKIYNTKNGHIQKEKLIANKFISKIDDVSTYSIQVRAAVSSPCRMPGRWGEWSQPIYVG
Molecular weight 36.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn32-Gly329
Aliases /Synonyms IL-5R subunit alpha, IL-5 receptor subunit alpha, IL5RA, IL-5RA, IL-5R-alpha, Interleukin-5 receptor subunit alpha, CDw125, CD125, IL5R
Reference ARO-P10601
Note For research use only.
Molecular Constructor
Asn32–Gly329
Product name ARO-P10601-50
Uniprot ID P21183
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence NFTIKATGLAQVLLHWDPNPDQEQRHVDLEYHVKINAPQEDEYDTRKTESKCVTPLHEGFAASVRTILKSSHTTLASSWVSAELKAPPGSPGTSVTNLTCTTHTVVSSHTHLRPYQVSLRCTWLVGKDAPEDTQYFLYYRFGVLTEKCQEYSRDALNRNTACWFPRTFINSKGFEQLAVHINGSSKRAAIKPFDQLFSPLAIDQVNPPRNVTVEIESNSLYIQWEKPLSAFPDHCFNYELKIYNTKNGHIQKEKLIANKFISKIDDVSTYSIQVRAAVSSPCRMPGRWGEWSQPIYVG
Molecular weight 36.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn32-Gly329
Aliases /Synonyms IL-5R subunit alpha, IL-5 receptor subunit alpha, IL5RA, IL-5RA, IL-5R-alpha, Interleukin-5 receptor subunit alpha, CDw125, CD125, IL5R
Reference ARO-P10601
Note For research use only.
Molecular Constructor
Asn32–Gly329

Introduction

Recombinant Mouse CD125/IL5RA Protein, also known as Interleukin 5 Receptor Alpha (IL5RA), is a protein that plays a crucial role in the immune system. It is a transmembrane protein that is expressed on the surface of various immune cells, including eosinophils, basophils, and mast cells. This protein is involved in the binding and signaling of Interleukin 5 (IL-5), a cytokine that regulates the growth and function of these immune cells. In this article, we will discuss the structure, activity, and applications of Recombinant Mouse CD125/IL5RA Protein.

Structure of Recombinant Mouse CD125/IL5RA Protein

Recombinant Mouse CD125/IL5RA Protein is a 60 kDa protein that is composed of 436 amino acids. It is a type I transmembrane protein, meaning that it has a single transmembrane domain that anchors it to the cell membrane. The extracellular domain of this protein contains several conserved cysteine residues that are important for its structural stability. The intracellular domain, on the other hand, is responsible for initiating downstream signaling upon ligand binding.

Activity of Recombinant Mouse CD125/IL5RA Protein

The main function of Recombinant Mouse CD125/IL5RA Protein is to bind to IL-5 and initiate downstream signaling. IL-5 is a cytokine that is produced by T helper 2 (Th2) cells and plays a critical role in the regulation of eosinophils, basophils, and mast cells. When IL-5 binds to Recombinant Mouse CD125/IL5RA Protein, it induces the dimerization of the receptor and activates the Janus Kinase (JAK)/Signal Transducer and Activator of Transcription (STAT) signaling pathway. This leads to the activation of various transcription factors that regulate the growth, survival, and function of these immune cells.

Applications of Recombinant Mouse CD125/IL5RA Protein

Recombinant Mouse CD125/IL5RA Protein has a wide range of applications in both basic research and clinical settings. Here are some of its key applications:

1. Studying IL-5 signaling

Recombinant Mouse CD125/IL5RA Protein is a valuable tool for studying the IL-5 signaling pathway. By blocking the interaction between IL-5 and its receptor, researchers can investigate the specific role of this cytokine in various cellular processes. This can provide insights into the pathogenesis of diseases such as asthma, allergies, and parasitic infections, where IL-5 plays a crucial role.

2. Screening for potential therapeutic agents

Since IL-5 is involved in the regulation of eosinophils, basophils, and mast cells, it has been targeted for the treatment of diseases such as asthma and eosinophilic disorders. Recombinant Mouse CD125/IL5RA Protein can be used in high-throughput screening assays to identify potential therapeutic agents that can block the IL-5 signaling pathway. This can aid in the development of new treatments for these diseases.

3. Production of antibodies

Recombinant Mouse CD125/IL5RA Protein can also be used as an antigen to produce antibodies that specifically recognize this protein. These antibodies can then be used in various immunoassays, such as Western blotting, immunohistochemistry, and flow cytometry, to detect and quantify the expression of Recombinant Mouse CD125/IL5RA Protein in different cell types and tissues.

4. Biomarker for disease diagnosis

Abnormal levels of IL-5 and its receptor have been associated with various diseases, including asthma, allergies, and parasitic infections. Therefore, measuring the expression of Recombinant Mouse CD125/IL5RA Protein can serve as a biomarker for these diseases. This can

Recombinant Mouse CD125/IL5RA Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD125/IL5RA Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products