Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse TIMP1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P12032
Molecular weight:
21.98 kDa

Original price was: €216.00.Current price is: €193.00.

50ug 11% OFF + 193 loyalty points
His31–Arg205
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse TIMP1 Protein, N-His

Product name ARO-P10605-100
Uniprot ID P12032
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTWRSLGAR
Molecular weight 21.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His31-Arg205
Aliases /Synonyms Erythroid-potentiating activity, TIMP, EPA, TIMP1, Metalloproteinase inhibitor 1, TIMP-1, Fibroblast collagenase inhibitor, Collagenase inhibitor, CLGI, Tissue inhibitor of metalloproteinases 1
Reference ARO-P10605
Note For research use only.
Molecular Constructor
His31–Arg205
Product name ARO-P10605-1MG
Uniprot ID P12032
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTWRSLGAR
Molecular weight 21.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His31-Arg205
Aliases /Synonyms Erythroid-potentiating activity, TIMP, EPA, TIMP1, Metalloproteinase inhibitor 1, TIMP-1, Fibroblast collagenase inhibitor, Collagenase inhibitor, CLGI, Tissue inhibitor of metalloproteinases 1
Reference ARO-P10605
Note For research use only.
Molecular Constructor
His31–Arg205
Product name ARO-P10605-50
Uniprot ID P12032
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTWRSLGAR
Molecular weight 21.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His31-Arg205
Aliases /Synonyms Erythroid-potentiating activity, TIMP, EPA, TIMP1, Metalloproteinase inhibitor 1, TIMP-1, Fibroblast collagenase inhibitor, Collagenase inhibitor, CLGI, Tissue inhibitor of metalloproteinases 1
Reference ARO-P10605
Note For research use only.
Molecular Constructor
His31–Arg205

Introduction

Recombinant Mouse TIMP1 Protein, also known as Tissue Inhibitor of Metalloproteinases 1, is a protein that plays a crucial role in regulating the activity of metalloproteinases, a group of enzymes that are involved in tissue remodeling and degradation. This protein is produced through recombinant DNA technology, making it highly pure and specific for research and therapeutic purposes. In this article, we will discuss the structure, activity, and applications of Recombinant Mouse TIMP1 Protein.

Structure of Recombinant Mouse TIMP1 Protein

Recombinant Mouse TIMP1 Protein is a 184 amino acid protein with a molecular weight of approximately 21 kDa. It is composed of a single polypeptide chain that contains a N-terminal domain and a C-terminal domain. The N-terminal domain of TIMP1 is responsible for its inhibitory activity, while the C-terminal domain is involved in binding to its target enzymes.

The three-dimensional structure of Recombinant Mouse TIMP1 Protein has been determined through X-ray crystallography. It has a compact globular structure with a central β-sheet surrounded by α-helices. This structure is similar to other members of the TIMP family, such as TIMP2 and TIMP3.

Activity of Recombinant Mouse TIMP1 Protein

Recombinant Mouse TIMP1 Protein is a potent inhibitor of metalloproteinases, including collagenases, gelatinases, and stromelysins. It binds to the active site of these enzymes and prevents their activity, thereby regulating tissue remodeling and degradation. TIMP1 has a higher affinity for matrix metalloproteinases (MMPs) than other members of the TIMP family, making it a key regulator of MMP activity in various tissues.

In addition to its inhibitory activity, Recombinant Mouse TIMP1 Protein also has anti-inflammatory and anti-tumor properties. It has been shown to suppress the production of pro-inflammatory cytokines and inhibit the growth and invasion of cancer cells. This makes it a potential therapeutic agent for inflammatory diseases and cancer.

Applications of Recombinant Mouse TIMP1 Protein

Recombinant Mouse TIMP1 Protein has a wide range of applications in both research and therapeutic settings. Its ability to inhibit MMP activity makes it a valuable tool for studying the role of MMPs in various physiological and pathological processes. It is commonly used in in vitro and in vivo experiments to investigate the effects of MMP inhibition on cell migration, invasion, and tissue remodeling.

In addition, Recombinant Mouse TIMP1 Protein has potential therapeutic applications. It has been studied as a potential treatment for diseases such as rheumatoid arthritis, osteoarthritis, and cancer. Clinical trials have shown promising results for the use of TIMP1 in combination with other treatments for these diseases.

Furthermore, Recombinant Mouse TIMP1 Protein has been used in the development of diagnostic tests for various diseases. Its levels have been found to be elevated in certain conditions, such as liver fibrosis and cardiovascular diseases, making it a potential biomarker for disease diagnosis and monitoring.

Conclusion

Recombinant Mouse TIMP1 Protein is a valuable protein in the field of research and therapeutics. Its structure and activity as an inhibitor of metalloproteinases make it a crucial regulator of tissue remodeling and inflammation. Its potential applications in various diseases make it a promising candidate for future research and development. With its high purity and specificity, Recombinant Mouse TIMP1 Protein is a valuable tool for scientists and clinicians alike.

Recombinant Mouse TIMP1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse TIMP1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products