Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD23/FCER2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P20693
Molecular weight:
16.26 kDa

Original price was: €299.00.Current price is: €230.00.

50ug 23% OFF + 230 loyalty points
Asn189–Ala309
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD23/FCER2 Protein, N-His

Product name ARO-P10600-100
Uniprot ID P20693
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence NWLHFQQKCYYFGKGSKQWIQARFACSDLQGRLVSIHSQKEQDFLMQHINKKDSWIGLQDLNMEGEFVWSDGSPVGYSNWNPGEPNNGGQGEDCVMMRGSGQWNDAFCRSYLDAWVCEQLA
Molecular weight 16.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn189-Ala309
Aliases /Synonyms Lymphocyte IgE receptor, C-type lectin domain family 4 member J, Low affinity immunoglobulin epsilon Fc receptor, CD23A, BLAST-2, Immunoglobulin E-binding factor, IGEBF, CD23, Fc-epsilon-RII, CLEC4J, FCE2, FCER2
Reference ARO-P10600
Note For research use only.
Molecular Constructor
Asn189–Ala309
Product name ARO-P10600-1MG
Uniprot ID P20693
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence NWLHFQQKCYYFGKGSKQWIQARFACSDLQGRLVSIHSQKEQDFLMQHINKKDSWIGLQDLNMEGEFVWSDGSPVGYSNWNPGEPNNGGQGEDCVMMRGSGQWNDAFCRSYLDAWVCEQLA
Molecular weight 16.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn189-Ala309
Aliases /Synonyms Lymphocyte IgE receptor, C-type lectin domain family 4 member J, Low affinity immunoglobulin epsilon Fc receptor, CD23A, BLAST-2, Immunoglobulin E-binding factor, IGEBF, CD23, Fc-epsilon-RII, CLEC4J, FCE2, FCER2
Reference ARO-P10600
Note For research use only.
Molecular Constructor
Asn189–Ala309
Product name ARO-P10600-50
Uniprot ID P20693
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence NWLHFQQKCYYFGKGSKQWIQARFACSDLQGRLVSIHSQKEQDFLMQHINKKDSWIGLQDLNMEGEFVWSDGSPVGYSNWNPGEPNNGGQGEDCVMMRGSGQWNDAFCRSYLDAWVCEQLA
Molecular weight 16.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn189-Ala309
Aliases /Synonyms Lymphocyte IgE receptor, C-type lectin domain family 4 member J, Low affinity immunoglobulin epsilon Fc receptor, CD23A, BLAST-2, Immunoglobulin E-binding factor, IGEBF, CD23, Fc-epsilon-RII, CLEC4J, FCE2, FCER2
Reference ARO-P10600
Note For research use only.
Molecular Constructor
Asn189–Ala309

Introduction

Recombinant Mouse CD23/FCER2 Protein is a genetically engineered protein that is derived from the mouse CD23 gene. This protein plays a crucial role in the immune system by acting as a receptor for IgE antibodies. In this article, we will discuss the structure, activity, and applications of this recombinant protein.

Structure of Recombinant Mouse CD23/FCER2 Protein

The recombinant mouse CD23/FCER2 protein is a type I transmembrane protein with a molecular weight of approximately 45 kDa. It consists of 375 amino acids and has a single transmembrane domain and two extracellular domains. The extracellular domains are responsible for binding to IgE antibodies and initiating downstream signaling pathways.

Activity of Recombinant Mouse CD23/FCER2 Protein

The main activity of recombinant mouse CD23/FCER2 protein is its role as a receptor for IgE antibodies. IgE antibodies are produced in response to allergens and play a crucial role in allergic reactions. When an allergen enters the body, it binds to IgE antibodies, which then bind to CD23/FCER2 receptors on the surface of immune cells.

Upon binding, the CD23/FCER2 receptors undergo a conformational change, leading to the activation of downstream signaling pathways. This results in the release of inflammatory mediators, such as histamine, which cause the symptoms of an allergic reaction. In addition to its role in allergic reactions, CD23/FCER2 also plays a role in regulating B cell activation and antibody production.

Applications of Recombinant Mouse CD23/FCER2 Protein

Recombinant Mouse CD23/FCER2 Protein has various applications in both research and clinical settings. One of its primary uses is in studying the mechanisms of allergic reactions. By using recombinant CD23/FCER2 protein, researchers can better understand the interactions between IgE antibodies and immune cells, leading to the development of new treatments for allergies.

Another application of recombinant CD23/FCER2 protein is in the development of diagnostic tests for allergies. By using this protein as an antigen, researchers can detect the presence of specific IgE antibodies in a patient’s blood, which can help in the diagnosis of allergies and the identification of specific allergens.

In addition to its role in allergies, recombinant CD23/FCER2 protein has also been studied for its potential use in immunotherapy. By targeting CD23/FCER2 receptors, researchers hope to develop treatments that can modulate the body’s immune response and potentially reduce the severity of allergic reactions.

Furthermore, recombinant CD23/FCER2 protein has also been studied for its potential use in cancer treatment. It has been found that CD23/FCER2 is overexpressed in certain types of cancer cells, and targeting this protein may lead to the development of new cancer therapies.

Conclusion

In conclusion, Recombinant Mouse CD23/FCER2 Protein is a crucial protein in the immune system that plays a significant role in allergic reactions, B cell activation, and antibody production. Its structure and activity make it an essential target for research and potential therapeutic applications in allergies and cancer. With further studies and developments, this recombinant protein has the potential to improve the lives of individuals suffering from allergies and other immune-related disorders.

Recombinant Mouse CD23/FCER2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD23/FCER2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products