Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD120b/TNFRSF1B/TNFR2 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P25119
Molecular weight:
29.27 kDa

Original price was: €262.00.Current price is: €230.00.

50ug 12% OFF + 230 loyalty points
Ser43–Asp199
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD120b/TNFRSF1B/TNFR2 Protein, N-His-SUMO

Product name ARO-P11095-100
Uniprot ID P25119
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SQEYYDRKAQMCCAKCPPGQYVKHFCNKTSDTVCADCEASMYTQVWNQFRTCLSCSSSCTTDQVEIRACTKQQNRVCACEAGRYCALKTHSGSCRQCMRLSKCGPGFGVASSRAPNGNVLCKACAPGTFSDTTSSTDVCRPHRICSILAIPGNASTD
Molecular weight 29.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser43-Asp199
Aliases /Synonyms TNF-R2, TNFR-II, p80 TNF-alpha receptor, Etanercept, TNFBR, TBP-2, TBPII, Tumor necrosis factor receptor superfamily member 1B, CD120b, p75, TNFRSF1B, Tumor necrosis factor receptor 2, TNF-RII, TNFR2, Tumor necrosis factor receptor type II
Reference ARO-P11095
Note For research use only.
Molecular Constructor
Ser43–Asp199
Product name ARO-P11095-1MG
Uniprot ID P25119
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SQEYYDRKAQMCCAKCPPGQYVKHFCNKTSDTVCADCEASMYTQVWNQFRTCLSCSSSCTTDQVEIRACTKQQNRVCACEAGRYCALKTHSGSCRQCMRLSKCGPGFGVASSRAPNGNVLCKACAPGTFSDTTSSTDVCRPHRICSILAIPGNASTD
Molecular weight 29.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser43-Asp199
Aliases /Synonyms TNF-R2, TNFR-II, p80 TNF-alpha receptor, Etanercept, TNFBR, TBP-2, TBPII, Tumor necrosis factor receptor superfamily member 1B, CD120b, p75, TNFRSF1B, Tumor necrosis factor receptor 2, TNF-RII, TNFR2, Tumor necrosis factor receptor type II
Reference ARO-P11095
Note For research use only.
Molecular Constructor
Ser43–Asp199
Product name ARO-P11095-50
Uniprot ID P25119
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SQEYYDRKAQMCCAKCPPGQYVKHFCNKTSDTVCADCEASMYTQVWNQFRTCLSCSSSCTTDQVEIRACTKQQNRVCACEAGRYCALKTHSGSCRQCMRLSKCGPGFGVASSRAPNGNVLCKACAPGTFSDTTSSTDVCRPHRICSILAIPGNASTD
Molecular weight 29.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser43-Asp199
Aliases /Synonyms TNF-R2, TNFR-II, p80 TNF-alpha receptor, Etanercept, TNFBR, TBP-2, TBPII, Tumor necrosis factor receptor superfamily member 1B, CD120b, p75, TNFRSF1B, Tumor necrosis factor receptor 2, TNF-RII, TNFR2, Tumor necrosis factor receptor type II
Reference ARO-P11095
Note For research use only.
Molecular Constructor
Ser43–Asp199

Introduction

Recombinant Mouse CD120b/TNFRSF1B/TNFR2 Protein, also known as tumor necrosis factor receptor 2 (TNFR2), is a protein that plays a crucial role in the immune system. This protein is a member of the tumor necrosis factor receptor superfamily and is encoded by the TNFRSF1B gene. Recombinant Mouse CD120b/TNFRSF1B/TNFR2 Protein is a widely studied protein due to its involvement in various physiological processes and its potential as a therapeutic target for various diseases.

Structure of Recombinant Mouse CD120b/TNFRSF1B/TNFR2 Protein

Recombinant Mouse CD120b/TNFRSF1B/TNFR2 Protein is a transmembrane protein that consists of 461 amino acids with a molecular weight of approximately 52 kDa. It is composed of an extracellular domain, a transmembrane domain, and an intracellular domain. The extracellular domain contains four cysteine-rich repeats, which are important for ligand binding. The intracellular domain contains a death domain, which is responsible for activating downstream signaling pathways upon ligand binding.

Activity of Recombinant Mouse CD120b/TNFRSF1B/TNFR2 Protein

The main function of Recombinant Mouse CD120b/TNFRSF1B/TNFR2 Protein is to bind to its ligand, tumor necrosis factor alpha (TNFα). This binding triggers a signaling cascade that leads to the activation of various cellular responses. The binding of TNFα to Recombinant Mouse CD120b/TNFRSF1B/TNFR2 Protein can result in either cell survival or cell death, depending on the cellular context. In general, TNFα binding to Recombinant Mouse CD120b/TNFRSF1B/TNFR2 Protein leads to the activation of pro-inflammatory pathways, which play a crucial role in the immune response.

Application of Recombinant Mouse CD120b/TNFRSF1B/TNFR2 Protein

Recombinant Mouse CD120b/TNFRSF1B/TNFR2 Protein has been extensively studied for its potential therapeutic applications. Due to its role in the immune response, it has been investigated as a target for various diseases, including autoimmune disorders, cancer, and infectious diseases. Recombinant Mouse CD120b/TNFRSF1B/TNFR2 Protein has also been studied for its potential as a biomarker for disease diagnosis and prognosis.

Autoimmune Disorders

Recombinant Mouse CD120b/TNFRSF1B/TNFR2 Protein has been shown to play a critical role in the development of autoimmune disorders. Autoimmune disorders occur when the immune system mistakenly attacks the body’s own tissues. Studies have shown that blocking the activity of Recombinant Mouse CD120b/TNFRSF1B/TNFR2 Protein can reduce the severity of symptoms in autoimmune diseases such as rheumatoid arthritis, multiple sclerosis, and psoriasis.

Cancer

Recombinant Mouse CD120b/TNFRSF1B/TNFR2 Protein has also been investigated as a potential target for cancer therapy. TNFα, the ligand for Recombinant Mouse CD120b/TNFRSF1B/TNFR2 Protein, has been shown to have both pro- and anti-tumor effects. By targeting Recombinant Mouse CD120b/TNFRSF1B/TNFR2 Protein, researchers hope to selectively activate the anti-tumor effects of TNFα, while minimizing its pro-tumor effects. This approach has shown promising results in preclinical studies for various types of cancer, including breast cancer, colon cancer, and melanoma.

Infectious Diseases

Infectious diseases are caused by pathogenic microorganisms, such as bacteria, viruses, and fungi. Recombinant Mouse CD120b/TNFRSF

Recombinant Mouse CD120b/TNFRSF1B/TNFR2 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Mouse CD120b/TNFRSF1B/TNFR2 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products