Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD16/FcRIII Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P08508
Molecular weight:
22.24 kDa

Original price was: €258.00.Current price is: €230.00.

50ug 11% OFF + 230 loyalty points
Ala35–Ser209
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD16/FcRIII Protein, N-His

Product name ARO-P11114-100
Uniprot ID P08508
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence AVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSIS
Molecular weight 22.24 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala35-Ser209
Aliases /Synonyms FcRIII, IgG Fc receptor III, Low affinity immunoglobulin gamma Fc region receptor III, Fcgr3, Fc-gamma RIII, CD16
Reference ARO-P11114
Note For research use only.
Molecular Constructor
Ala35–Ser209
Product name ARO-P11114-1MG
Uniprot ID P08508
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence AVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSIS
Molecular weight 22.24 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala35-Ser209
Aliases /Synonyms FcRIII, IgG Fc receptor III, Low affinity immunoglobulin gamma Fc region receptor III, Fcgr3, Fc-gamma RIII, CD16
Reference ARO-P11114
Note For research use only.
Molecular Constructor
Ala35–Ser209
Product name ARO-P11114-50
Uniprot ID P08508
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence AVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSIS
Molecular weight 22.24 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala35-Ser209
Aliases /Synonyms FcRIII, IgG Fc receptor III, Low affinity immunoglobulin gamma Fc region receptor III, Fcgr3, Fc-gamma RIII, CD16
Reference ARO-P11114
Note For research use only.
Molecular Constructor
Ala35–Ser209

Introduction

Recombinant Mouse CD16/FcRIII protein is a type of recombinant protein that plays an important role in the immune system. This protein is a member of the Fc receptor family and is found on the surface of certain immune cells, including natural killer (NK) cells and macrophages. In this article, we will discuss the structure, activity, and application of Recombinant Mouse CD16/FcRIII protein.

Structure

Recombinant Mouse CD16/FcRIII protein is composed of two subunits, designated as CD16A and CD16B. These subunits are encoded by two different genes, Fcgr3a and Fcgr3b, respectively. The CD16A subunit is a transmembrane protein, whereas the CD16B subunit is a glycosylphosphatidylinositol (GPI)-anchored protein. Both subunits are essential for the proper function of the CD16/FcRIII protein.

The extracellular region of CD16A contains two Ig-like domains, whereas the extracellular region of CD16B contains only one Ig-like domain. These domains are responsible for binding to the Fc portion of immunoglobulins (Ig), specifically IgG. This binding is crucial for the activation of immune cells and the initiation of immune responses.

Activity

Recombinant Mouse CD16/FcRIII protein is primarily known for its role in antibody-dependent cell-mediated cytotoxicity (ADCC). This is a process in which immune cells, such as NK cells and macrophages, recognize and kill target cells that are coated with antibodies. The binding of CD16/FcRIII to the Fc portion of IgG antibodies triggers the activation of immune cells, leading to the release of cytotoxic molecules and the destruction of the target cell.

In addition to ADCC, CD16/FcRIII also plays a role in phagocytosis, which is the process of engulfing and digesting foreign particles or cells. This activity is mediated by macrophages, which express high levels of CD16/FcRIII on their surface. The binding of IgG-coated particles to CD16/FcRIII on macrophages triggers the activation of phagocytosis, helping to clear foreign invaders from the body.

Application

Recombinant Mouse CD16/FcRIII protein has a wide range of applications in both research and clinical settings. In research, this protein is commonly used to study the mechanisms of ADCC and phagocytosis. It is also used to investigate the role of CD16/FcRIII in various immune responses and diseases.

In clinical settings, recombinant CD16/FcRIII protein is used as a therapeutic agent in cancer treatment. Monoclonal antibodies that target specific cancer cells are often used in combination with recombinant CD16/FcRIII protein to enhance the efficacy of ADCC. This approach has shown promising results in clinical trials, particularly in the treatment of hematological malignancies.

Furthermore, recombinant CD16/FcRIII protein is also being investigated as a potential treatment for autoimmune diseases, such as rheumatoid arthritis and lupus. By targeting and activating immune cells, CD16/FcRIII protein can help regulate the immune response and reduce inflammation in these diseases.

Conclusion

Recombinant Mouse CD16/FcRIII protein is a crucial component of the immune system, playing a key role in antibody-mediated immune responses. Its structure, activity, and application have been extensively studied and have led to significant advances in both research and clinical settings. With ongoing research and development, this protein holds great potential for the treatment of various diseases and disorders in the future.

Recombinant Mouse CD16/FcRIII Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD16/FcRIII Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products