Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse S100A8 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P27005
Molecular weight:
22.50 kDa

Original price was: €227.00.Current price is: €188.00.

50ug 17% OFF + 188 loyalty points
Pro2–Glu89
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse S100A8 Protein, N-His-SUMO

Product name ARO-P11065-100
Uniprot ID P27005
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE
Molecular weight 22.50 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro2-Glu89
Aliases /Synonyms Caga, S100 calcium-binding protein A8, Protein S100-A8, Calgranulin-A, Mrp8, Chemotactic cytokine CP-10, p8, Leukocyte L1 complex light chain, S100a8, Migration inhibitory factor-related protein 8, Pro-inflammatory S100 cytokine, MRP-8
Reference ARO-P11065
Note For research use only.
Molecular Constructor
Pro2–Glu89
Product name ARO-P11065-1MG
Uniprot ID P27005
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE
Molecular weight 22.50 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro2-Glu89
Aliases /Synonyms Caga, S100 calcium-binding protein A8, Protein S100-A8, Calgranulin-A, Mrp8, Chemotactic cytokine CP-10, p8, Leukocyte L1 complex light chain, S100a8, Migration inhibitory factor-related protein 8, Pro-inflammatory S100 cytokine, MRP-8
Reference ARO-P11065
Note For research use only.
Molecular Constructor
Pro2–Glu89
Product name ARO-P11065-50
Uniprot ID P27005
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE
Molecular weight 22.50 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro2-Glu89
Aliases /Synonyms Caga, S100 calcium-binding protein A8, Protein S100-A8, Calgranulin-A, Mrp8, Chemotactic cytokine CP-10, p8, Leukocyte L1 complex light chain, S100a8, Migration inhibitory factor-related protein 8, Pro-inflammatory S100 cytokine, MRP-8
Reference ARO-P11065
Note For research use only.
Molecular Constructor
Pro2–Glu89

Introduction

Recombinant Mouse S100A8 Protein is a synthetic form of the S100A8 protein that is produced through the process of recombinant DNA technology. This protein is a member of the S100 family of calcium-binding proteins and is involved in various cellular processes such as inflammation, immune response, and cell differentiation. In this article, we will discuss the structure, activity, and applications of this important protein.

Structure

The recombinant mouse S100A8 protein is made up of 93 amino acids with a molecular weight of approximately 10 kDa. It contains two calcium-binding EF-hand motifs and forms a homodimer in its active form. The crystal structure of this protein has been extensively studied and it has been found that the dimerization of S100A8 is crucial for its biological activity.

Activity

S100A8 protein is known to play a crucial role in inflammation and immune response. It is primarily expressed by neutrophils and monocytes and is involved in the recruitment and activation of immune cells at the site of inflammation. The calcium-binding activity of S100A8 is essential for its interaction with target proteins and its subsequent biological effects. It has been shown to bind to various receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation end products (RAGE), leading to the activation of downstream signaling pathways.

Applications

Recombinant Protein Production

Recombinant mouse S100A8 protein is widely used in the production of recombinant proteins. It is often used as a fusion partner with other proteins to improve their solubility and stability. The calcium-binding activity of S100A8 also helps in the purification of recombinant proteins through affinity chromatography.

Antigen in Immunological Studies

S100A8 protein has been identified as an important antigen in various immunological studies. It is known to induce an immune response and is often used as a target in diagnostic assays for autoimmune diseases such as rheumatoid arthritis and systemic lupus erythematosus. Recombinant S100A8 protein is also used in the development of vaccines and immunotherapies for various diseases.

Inflammation Research

Due to its role in inflammation, recombinant mouse S100A8 protein is widely used in research studies related to inflammatory diseases. It is often used to induce inflammation in animal models and to study the mechanisms involved in the inflammatory response. The use of recombinant S100A8 protein has also provided insights into potential therapeutic targets for inflammatory conditions.

Cell Differentiation Studies

S100A8 protein has been shown to play a role in cell differentiation and is involved in the regulation of various cellular processes such as cell growth and migration. Recombinant S100A8 protein is used in cell culture studies to understand its role in cell differentiation and its potential implications in cancer and other diseases.

Diagnostic Applications

Recombinant S100A8 protein is also used in diagnostic applications such as ELISA and western blotting to detect its presence in various biological samples. Its use as a biomarker has been explored in various diseases such as sepsis, inflammatory bowel disease, and cancer.

Therapeutic Applications

The potential therapeutic applications of recombinant mouse S100A8 protein are currently being investigated. It has been shown to have anti-inflammatory properties and has been proposed as a potential treatment for inflammatory diseases. Its

Recombinant Mouse S100A8 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Mouse S100A8 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products