Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse BID Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P70444
Molecular weight:
23.48 kDa

Original price was: €333.00.Current price is: €275.00.

100ug 17% OFF + 275 loyalty points
Gly8–Asp195
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse BID Protein, N-His

Product name ARO-P10569-100
Uniprot ID P70444
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GSGLGAEHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQNLFSYVRNLVRNEMD
Molecular weight 23.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly8-Asp195
Aliases /Synonyms BH3-interacting domain death agonist, p11 BID, p13 BID, p15 BID, BID, p22 BID
Reference ARO-P10569
Note For research use only.
Molecular Constructor
Gly8–Asp195
Product name ARO-P10569-1MG
Uniprot ID P70444
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GSGLGAEHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQNLFSYVRNLVRNEMD
Molecular weight 23.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly8-Asp195
Aliases /Synonyms BH3-interacting domain death agonist, p11 BID, p13 BID, p15 BID, BID, p22 BID
Reference ARO-P10569
Note For research use only.
Molecular Constructor
Gly8–Asp195
Product name ARO-P10569-50
Uniprot ID P70444
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GSGLGAEHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQNLFSYVRNLVRNEMD
Molecular weight 23.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly8-Asp195
Aliases /Synonyms BH3-interacting domain death agonist, p11 BID, p13 BID, p15 BID, BID, p22 BID
Reference ARO-P10569
Note For research use only.
Molecular Constructor
Gly8–Asp195

Introduction

Recombinant Mouse BID Protein, also known as BH3-interacting domain death agonist, is a member of the Bcl-2 protein family. It plays a crucial role in regulating apoptosis, or programmed cell death, by promoting the release of cytochrome c from the mitochondria. This protein has been extensively studied for its structure, activity, and potential applications in various fields. In this article, we will delve into the details of Recombinant Mouse BID Protein, highlighting its structure, activity, and potential applications.

Structure of Recombinant Mouse BID Protein

Recombinant Mouse BID Protein is a 195 amino acid protein with a molecular weight of 22 kDa. It is composed of three major domains: the BH3 domain, the α-helical domain, and the C-terminal domain. The BH3 domain, also known as the Bcl-2 homology 3 domain, is responsible for the interaction with other Bcl-2 family proteins. The α-helical domain is responsible for the insertion of BID into the mitochondrial membrane, while the C-terminal domain contains the death domain, which is involved in the activation of apoptosis.

Activity of Recombinant Mouse BID Protein

Recombinant Mouse BID Protein plays a crucial role in the regulation of apoptosis. It is activated by various stimuli, such as DNA damage, growth factor withdrawal, and cytokine signaling. Upon activation, BID translocates to the mitochondria and interacts with other Bcl-2 family proteins, such as Bax and Bak. This interaction leads to the formation of pores in the mitochondrial membrane, resulting in the release of cytochrome c. Cytochrome c then activates caspases, which are enzymes responsible for the execution of apoptosis.

In addition to its role in apoptosis, Recombinant Mouse BID Protein has also been found to play a role in other cellular processes. It has been shown to regulate autophagy, a process that involves the degradation of damaged or unnecessary cellular components. BID has also been implicated in the regulation of cell migration and invasion, suggesting its potential role in cancer progression.

Applications of Recombinant Mouse BID Protein

Recombinant Mouse BID Protein has a wide range of potential applications in various fields, including cancer research, drug discovery, and therapeutic development. Its role in apoptosis and other cellular processes makes it a promising target for cancer treatment. In fact, BID deficiency has been linked to increased tumor growth and resistance to chemotherapy. Therefore, targeting BID could potentially lead to the development of new cancer therapies.

In addition, Recombinant Mouse BID Protein has also been used in drug discovery and screening. Its ability to regulate apoptosis and autophagy makes it a valuable tool in identifying potential drug candidates for the treatment of various diseases. BID has also been studied for its potential role in neurodegenerative diseases, such as Alzheimer’s and Parkinson’s, and its potential as a therapeutic target for these conditions.

Furthermore, Recombinant Mouse BID Protein has been used in various research studies to understand its structure and function. Its recombinant form allows for easier purification and manipulation, making it a valuable tool for studying its role in apoptosis and other cellular processes.

Conclusion

In conclusion, Recombinant Mouse BID Protein is a crucial member of the Bcl-2 protein family, playing a significant role in regulating apoptosis and other cellular processes. Its structure and activity have been extensively studied, and its potential applications in cancer research, drug discovery, and therapeutic development hold great promise for future advancements in these fields. Further research on this protein will undoubtedly uncover more insights into its role in cellular processes and its potential as a therapeutic target.

SDS-PAGE for Recombinant Mouse BID Protein, N-His

SDS-PAGE for Recombinant Mouse BID Protein, N-His

Recombinant Mouse BID Protein, N-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Recombinant Mouse BID Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse BID Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products